Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250516 800 bp mRNA linear INV 02-SEP-2023 (LOC106086015), mRNA. ACCESSION XM_013250516 VERSION XM_013250516.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250516.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..800 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..800 /gene="LOC106086015" /note="uncharacterized LOC106086015; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106086015" CDS 353..676 /gene="LOC106086015" /codon_start=1 /product="uncharacterized protein LOC106086015" /protein_id="XP_013105970.1" /db_xref="GeneID:106086015" /translation="MEKFFKPYMWKFIIICIIFGLFFINLTEAGWTAQCWKKHNSGSI QTPEGEFKRPFGILCTYQCFLWFHPVFPYCEFIFDLRLSRHFTVLPDCYEVHCNETFS FFNSG" ORIGIN 1 cacatccaca tcagcatcaa catcagcttt atgctgctca tcatccattt ggatgatgat 61 agtagctcta cactttacat ggccccagcg aatattatca tcgtagttta attcaagcat 121 tgcttcgcat aacgacattt ttcgggggat ttcatagcga aatcaaagaa aatctctttt 181 tcttgttgtg tggaaaaaaa attcacttag cgggtgtttg tgtgtgtgtg tgtctgttgg 241 ttgtatcgtg aaaattttca tgcgggaaat tgtacgtgcc gaattgaaag tgtattgtgg 301 ctttttggtc tcattctgat atgaatttca taaatcattt gctcaagaga aaatggaaaa 361 attctttaag ccatatatgt ggaaatttat cataatttgt attatatttg gattattttt 421 cataaattta acggaagcgg gatggacggc acaatgttgg aaaaaacata attccggttc 481 aattcaaacg cctgagggcg aatttaaacg cccttttggc attttgtgca catatcaatg 541 ttttctgtgg tttcatccag ttttccccta ttgtgaattt atctttgatt tgagattgtc 601 gcgccatttt actgttttgc ccgactgcta tgaggtgcat tgcaatgaga ctttcagttt 661 cttcaacagc ggctgagcag ggatgactcg ataaaaattg ttaaataaaa ttctaaaatt 721 atgtaaaaaa aaaaaatgtt tttaggctaa gtatttgtat tgcaaaattt gttataaata 781 aaatgagaaa ttaaatataa