Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250514 726 bp mRNA linear INV 02-SEP-2023 (LOC106086013), transcript variant X2, mRNA. ACCESSION XM_013250514 VERSION XM_013250514.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250514.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..726 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..726 /gene="LOC106086013" /note="uncharacterized protein CG1552; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106086013" CDS 169..630 /gene="LOC106086013" /codon_start=1 /product="uncharacterized protein CG1552 isoform X2" /protein_id="XP_013105968.1" /db_xref="GeneID:106086013" /translation="MLKHLLVLAIMLTSCYGFGQFHMKKYTPPVDSDEQATNSVLRTY RRCLWEQSKSLPRRLVLLSLCQNLFCENNQIMARSSCLDILPDQCEQGDEEELMYKPF PDCCPVYCNLKRRMQRLKTMHFRHRLLLDLQRQQAAGATNLLLNEYGLEGI" polyA_site 726 /gene="LOC106086013" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caagccagcc cacagttagt ggccttttaa gcacttcaac gaaacaaact cgggagaaat 61 atattttttt ttttttttgt tgtgtttcaa ttcaattgtg atatttcaca ttcttttaaa 121 aatcactttg aaaacaaaaa actgtgaaaa aaaaagaaag tgtacaaaat gttaaaacac 181 ttactggtgt tggccatcat gttgacatct tgttatggct ttggtcaatt tcatatgaaa 241 aaatatacac cacctgtcga ctcggatgaa caggcaacaa atagtgtcct aagaacctat 301 cgccgttgcc tgtgggaaca atcgaaatcc ttgcccaggc gcttggtatt gctcagtttg 361 tgccagaatt tgttttgtga aaacaatcaa attatggcca gatccagctg cttggacatt 421 ttacccgatc aatgtgaaca aggcgatgaa gaggagctca tgtataaacc attccccgat 481 tgctgtcctg tttattgtaa tctaaagcga cgtatgcaac gcttgaagac catgcatttc 541 cgtcatcgtt tgctattgga tttgcagcga caacaggcag caggtgctac aaatctattg 601 ctcaatgaat atggattgga gggcatttaa ggggaaagca tcacaacgca agcagcaaaa 661 agttatgatg ttatgaaaat gtctaaaaca tgtaaaataa atttgttata agaaaaagca 721 aaacaa