Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized protein CG1552


LOCUS       XM_013250514             726 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086013), transcript variant X2, mRNA.
ACCESSION   XM_013250514
VERSION     XM_013250514.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250514.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..726
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..726
                     /gene="LOC106086013"
                     /note="uncharacterized protein CG1552; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:106086013"
     CDS             169..630
                     /gene="LOC106086013"
                     /codon_start=1
                     /product="uncharacterized protein CG1552 isoform X2"
                     /protein_id="XP_013105968.1"
                     /db_xref="GeneID:106086013"
                     /translation="MLKHLLVLAIMLTSCYGFGQFHMKKYTPPVDSDEQATNSVLRTY
                     RRCLWEQSKSLPRRLVLLSLCQNLFCENNQIMARSSCLDILPDQCEQGDEEELMYKPF
                     PDCCPVYCNLKRRMQRLKTMHFRHRLLLDLQRQQAAGATNLLLNEYGLEGI"
     polyA_site      726
                     /gene="LOC106086013"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caagccagcc cacagttagt ggccttttaa gcacttcaac gaaacaaact cgggagaaat
       61 atattttttt ttttttttgt tgtgtttcaa ttcaattgtg atatttcaca ttcttttaaa
      121 aatcactttg aaaacaaaaa actgtgaaaa aaaaagaaag tgtacaaaat gttaaaacac
      181 ttactggtgt tggccatcat gttgacatct tgttatggct ttggtcaatt tcatatgaaa
      241 aaatatacac cacctgtcga ctcggatgaa caggcaacaa atagtgtcct aagaacctat
      301 cgccgttgcc tgtgggaaca atcgaaatcc ttgcccaggc gcttggtatt gctcagtttg
      361 tgccagaatt tgttttgtga aaacaatcaa attatggcca gatccagctg cttggacatt
      421 ttacccgatc aatgtgaaca aggcgatgaa gaggagctca tgtataaacc attccccgat
      481 tgctgtcctg tttattgtaa tctaaagcga cgtatgcaac gcttgaagac catgcatttc
      541 cgtcatcgtt tgctattgga tttgcagcga caacaggcag caggtgctac aaatctattg
      601 ctcaatgaat atggattgga gggcatttaa ggggaaagca tcacaacgca agcagcaaaa
      661 agttatgatg ttatgaaaat gtctaaaaca tgtaaaataa atttgttata agaaaaagca
      721 aaacaa