Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized protein CG1552


LOCUS       XM_013250513             767 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106086013), transcript variant X1, mRNA.
ACCESSION   XM_013250513
VERSION     XM_013250513.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250513.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..767
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..767
                     /gene="LOC106086013"
                     /note="uncharacterized protein CG1552; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106086013"
     CDS             171..671
                     /gene="LOC106086013"
                     /codon_start=1
                     /product="uncharacterized protein CG1552 isoform X1"
                     /protein_id="XP_013105967.1"
                     /db_xref="GeneID:106086013"
                     /translation="MLKHLLVLAIMLTSCYGFGQFHMKKYTPPVDSDEQATNSVLRTY
                     RRCLWEQSKSLPRRLVLLSLCQNLFCENNQIMARSRSIFVVEKMARPNDCLDILPDQC
                     EQGDEEELMYKPFPDCCPVYCNLKRRMQRLKTMHFRHRLLLDLQRQQAAGATNLLLNE
                     YGLEGI"
     polyA_site      767
                     /gene="LOC106086013"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccaagccag cccacagtta gtggcctttt aagcacttca acgaaacaaa ctcgggagaa
       61 atatattttt tttttttttt gttgtgtttc aattcaattg tgatatttca cattctttta
      121 aaaatcactt tgaaaacaaa aaactgtgaa aaaaaaagaa agtgtacaaa atgttaaaac
      181 acttactggt gttggccatc atgttgacat cttgttatgg ctttggtcaa tttcatatga
      241 aaaaatatac accacctgtc gactcggatg aacaggcaac aaatagtgtc ctaagaacct
      301 atcgccgttg cctgtgggaa caatcgaaat ccttgcccag gcgcttggta ttgctcagtt
      361 tgtgccagaa tttgttttgt gaaaacaatc aaattatggc cagatccagg tctatttttg
      421 tagtcgaaaa gatggcaaga cccaatgact gcttggacat tttacccgat caatgtgaac
      481 aaggcgatga agaggagctc atgtataaac cattccccga ttgctgtcct gtttattgta
      541 atctaaagcg acgtatgcaa cgcttgaaga ccatgcattt ccgtcatcgt ttgctattgg
      601 atttgcagcg acaacaggca gcaggtgcta caaatctatt gctcaatgaa tatggattgg
      661 agggcattta aggggaaagc atcacaacgc aagcagcaaa aagttatgat gttatgaaaa
      721 tgtctaaaac atgtaaaata aatttgttat aagaaaaagc aaaacaa