Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250513 767 bp mRNA linear INV 02-SEP-2023 (LOC106086013), transcript variant X1, mRNA. ACCESSION XM_013250513 VERSION XM_013250513.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250513.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..767 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..767 /gene="LOC106086013" /note="uncharacterized protein CG1552; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106086013" CDS 171..671 /gene="LOC106086013" /codon_start=1 /product="uncharacterized protein CG1552 isoform X1" /protein_id="XP_013105967.1" /db_xref="GeneID:106086013" /translation="MLKHLLVLAIMLTSCYGFGQFHMKKYTPPVDSDEQATNSVLRTY RRCLWEQSKSLPRRLVLLSLCQNLFCENNQIMARSRSIFVVEKMARPNDCLDILPDQC EQGDEEELMYKPFPDCCPVYCNLKRRMQRLKTMHFRHRLLLDLQRQQAAGATNLLLNE YGLEGI" polyA_site 767 /gene="LOC106086013" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tccaagccag cccacagtta gtggcctttt aagcacttca acgaaacaaa ctcgggagaa 61 atatattttt tttttttttt gttgtgtttc aattcaattg tgatatttca cattctttta 121 aaaatcactt tgaaaacaaa aaactgtgaa aaaaaaagaa agtgtacaaa atgttaaaac 181 acttactggt gttggccatc atgttgacat cttgttatgg ctttggtcaa tttcatatga 241 aaaaatatac accacctgtc gactcggatg aacaggcaac aaatagtgtc ctaagaacct 301 atcgccgttg cctgtgggaa caatcgaaat ccttgcccag gcgcttggta ttgctcagtt 361 tgtgccagaa tttgttttgt gaaaacaatc aaattatggc cagatccagg tctatttttg 421 tagtcgaaaa gatggcaaga cccaatgact gcttggacat tttacccgat caatgtgaac 481 aaggcgatga agaggagctc atgtataaac cattccccga ttgctgtcct gtttattgta 541 atctaaagcg acgtatgcaa cgcttgaaga ccatgcattt ccgtcatcgt ttgctattgg 601 atttgcagcg acaacaggca gcaggtgcta caaatctatt gctcaatgaa tatggattgg 661 agggcattta aggggaaagc atcacaacgc aagcagcaaa aagttatgat gttatgaaaa 721 tgtctaaaac atgtaaaata aatttgttat aagaaaaagc aaaacaa