PREDICTED: Stomoxys calcitrans fibrinogen C domain-containing

LOCUS       XM_013250509             681 bp    mRNA    linear   INV 02-SEP-2023
            protein 1-like (LOC106086010), mRNA.
ACCESSION   XM_013250509
VERSION     XM_013250509.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250509.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 32% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..681
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..681
                     /gene="LOC106086010"
                     /note="fibrinogen C domain-containing protein 1-like;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins"
                     /db_xref="GeneID:106086010"
     CDS             1..681
                     /gene="LOC106086010"
                     /codon_start=1
                     /product="fibrinogen C domain-containing protein 1-like"
                     /protein_id="XP_013105963.2"
                     /db_xref="GeneID:106086010"
                     /translation="MLENLQGRLNGRAYDLNRAKQHFQNLEKRIADQKKVTNGREALL
                     NEFQTSTWTTFQRRQDGSVNFHRNWTEYKNGFGNAPQGEFFLGLQKLHELTSEAPHEL
                     LVILRDWQDDVRYAHYDHFAVGSENEKYSLMELGLYSGNAGDDLKNFKGMKFSTFDSD
                     NDASDEFHCAELFTGGWWFESCGLSNLNGRYLKGRDSSTGVTWSEWRGEEYSLKFAEM
                     KIRRKNVA"
ORIGIN      
        1 atgttggaga acctacaggg tagactcaac ggacgagcct atgatttaaa tcgggcaaaa
       61 caacatttcc aaaatttaga gaaaagaatt gcagatcaaa agaaagtaac aaacggccgt
      121 gaagccttgc tgaacgaatt ccaaacttca acttggacta cctttcaacg tcgccaagat
      181 ggctctgtaa atttccatcg caattggact gaatataaaa acggctttgg taatgctccc
      241 caaggcgaat tctttttggg tctacaaaaa cttcatgaac ttacttcaga ggcaccacat
      301 gaactattgg tcattttgag agattggcaa gatgatgtac gttatgccca ctatgatcac
      361 tttgcagtgg gtagtgaaaa tgagaaatat tcacttatgg aattgggttt gtatagtggc
      421 aatgctggtg atgatttgaa aaacttcaaa ggcatgaagt tttcaacatt tgattccgac
      481 aatgatgcta gtgatgaatt tcattgtgca gaacttttca ccggtggatg gtggtttgaa
      541 agttgcggtc taagcaattt aaatggtcgt tatttaaaag gaagagattc aagcactggc
      601 gtgacctggt ctgaatggag aggtgaagag tactctttga aatttgctga aatgaaaata
      661 cgccgcaaga atgtggcata a