Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans large ribosomal subunit protein uL22


LOCUS       XM_013250409             860 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085922), mRNA.
ACCESSION   XM_013250409
VERSION     XM_013250409.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250409.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..860
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..860
                     /gene="LOC106085922"
                     /note="large ribosomal subunit protein uL22; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 EST, 32 Proteins"
                     /db_xref="GeneID:106085922"
     CDS             114..674
                     /gene="LOC106085922"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL22"
                     /protein_id="XP_013105863.1"
                     /db_xref="GeneID:106085922"
                     /translation="MGRYSREPETAAKACKARGPNLRVHFKNTHETAQAIKRMPLRRA
                     QRFLKAVIEQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANA
                     DYKGLDVDRLVVDHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILTEKEEIVAKA
                     ADDEPAKKKLSKKKMQRQKEKMMRSE"
     misc_feature    114..599
                     /gene="LOC106085922"
                     /note="60S ribosomal protein L17; Provisional; Region:
                     PTZ00178"
                     /db_xref="CDD:240306"
     misc_feature    order(156..161,225..233,237..242,246..251,408..425,
                     447..464,558..563)
                     /gene="LOC106085922"
                     /note="putative translocon binding site [active]"
                     /db_xref="CDD:238205"
     misc_feature    order(165..167,171..173,180..182,186..194,201..203,
                     213..215,222..224,402..404,414..416,423..425,459..461,
                     465..473,477..479,486..488,522..539)
                     /gene="LOC106085922"
                     /note="protein-rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238205"
     polyA_site      860
                     /gene="LOC106085922"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgctgtcacc aatgccaacc ctgtatttgc acggccttac cctccttttg gcagctgtca
       61 aaaaagttct tttccggttt aattcactaa gaagaagaaa ttaaacacaa accatgggtc
      121 gctactccag ggaaccagag acagccgcca aggcttgcaa ggcccgtgga ccaaatctac
      181 gtgtgcattt caagaacacc cacgagactg cccaagccat caaacgtatg cctttgcgtc
      241 gtgcccaacg tttcttgaag gctgtcattg aacaaaagga atgtgttccc ttccgccgtt
      301 tcaatggtgg tgttggccgt tgtgcccaag ccaagcagtg gaagaccact caaggtcgct
      361 ggcccaagaa atccgctgaa ttccttttgc aattgctccg caatgccgaa gccaatgctg
      421 actacaaagg tctcgatgtt gatcgtttgg ttgtcgatca cattcaagtg aatcgtgccc
      481 aatgcttgcg tcgtcgtacc tatcgtgctc atggtcgcat caacccctat atgtcctcac
      541 cctgccacgt tgaggttatt cttaccgaaa aggaagaaat tgttgccaag gccgccgatg
      601 atgagcccgc caaaaagaag ttgtccaaga agaagatgca aaggcaaaag gagaaaatga
      661 tgcgctccga ataagatgac atcgtttgcg cgatgttaga gcgttaagtt tcttttatgt
      721 gtaataaatt ttttttaaat taggcgtatt gttggacagt tgagatttgt aatgcaacct
      781 acaaagagct acgttccaag aaaaatatgt atgttcaaat aaaaagatcg cttttgaacg
      841 ctgtttttta agaaatgaaa