Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250409 860 bp mRNA linear INV 02-SEP-2023 (LOC106085922), mRNA. ACCESSION XM_013250409 VERSION XM_013250409.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250409.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..860 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..860 /gene="LOC106085922" /note="large ribosomal subunit protein uL22; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 32 Proteins" /db_xref="GeneID:106085922" CDS 114..674 /gene="LOC106085922" /codon_start=1 /product="large ribosomal subunit protein uL22" /protein_id="XP_013105863.1" /db_xref="GeneID:106085922" /translation="MGRYSREPETAAKACKARGPNLRVHFKNTHETAQAIKRMPLRRA QRFLKAVIEQKECVPFRRFNGGVGRCAQAKQWKTTQGRWPKKSAEFLLQLLRNAEANA DYKGLDVDRLVVDHIQVNRAQCLRRRTYRAHGRINPYMSSPCHVEVILTEKEEIVAKA ADDEPAKKKLSKKKMQRQKEKMMRSE" misc_feature 114..599 /gene="LOC106085922" /note="60S ribosomal protein L17; Provisional; Region: PTZ00178" /db_xref="CDD:240306" misc_feature order(156..161,225..233,237..242,246..251,408..425, 447..464,558..563) /gene="LOC106085922" /note="putative translocon binding site [active]" /db_xref="CDD:238205" misc_feature order(165..167,171..173,180..182,186..194,201..203, 213..215,222..224,402..404,414..416,423..425,459..461, 465..473,477..479,486..488,522..539) /gene="LOC106085922" /note="protein-rRNA interface [nucleotide binding]; other site" /db_xref="CDD:238205" polyA_site 860 /gene="LOC106085922" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgctgtcacc aatgccaacc ctgtatttgc acggccttac cctccttttg gcagctgtca 61 aaaaagttct tttccggttt aattcactaa gaagaagaaa ttaaacacaa accatgggtc 121 gctactccag ggaaccagag acagccgcca aggcttgcaa ggcccgtgga ccaaatctac 181 gtgtgcattt caagaacacc cacgagactg cccaagccat caaacgtatg cctttgcgtc 241 gtgcccaacg tttcttgaag gctgtcattg aacaaaagga atgtgttccc ttccgccgtt 301 tcaatggtgg tgttggccgt tgtgcccaag ccaagcagtg gaagaccact caaggtcgct 361 ggcccaagaa atccgctgaa ttccttttgc aattgctccg caatgccgaa gccaatgctg 421 actacaaagg tctcgatgtt gatcgtttgg ttgtcgatca cattcaagtg aatcgtgccc 481 aatgcttgcg tcgtcgtacc tatcgtgctc atggtcgcat caacccctat atgtcctcac 541 cctgccacgt tgaggttatt cttaccgaaa aggaagaaat tgttgccaag gccgccgatg 601 atgagcccgc caaaaagaag ttgtccaaga agaagatgca aaggcaaaag gagaaaatga 661 tgcgctccga ataagatgac atcgtttgcg cgatgttaga gcgttaagtt tcttttatgt 721 gtaataaatt ttttttaaat taggcgtatt gttggacagt tgagatttgt aatgcaacct 781 acaaagagct acgttccaag aaaaatatgt atgttcaaat aaaaagatcg cttttgaacg 841 ctgtttttta agaaatgaaa