Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans iron-sulfur cluster assembly 1


LOCUS       XM_013250398             675 bp    mRNA    linear   INV 02-SEP-2023
            homolog, mitochondrial (LOC106085914), mRNA.
ACCESSION   XM_013250398
VERSION     XM_013250398.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250398.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..675
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..675
                     /gene="LOC106085914"
                     /note="iron-sulfur cluster assembly 1 homolog,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 16 Proteins"
                     /db_xref="GeneID:106085914"
     CDS             153..545
                     /gene="LOC106085914"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly 1 homolog,
                     mitochondrial"
                     /protein_id="XP_013105852.1"
                     /db_xref="GeneID:106085914"
                     /translation="MATKVVATATVRALKGRKLLPTRAALTLTPSAVQRIKDLLKGQP
                     EYTGLKVGVRQRGCNGLSYTLNYAKEKDKLDEEVVQDGVRVYIDRKAQLSLLGTEMDY
                     VESKLASEFVFNNPNIKGTCGCGESFSI"
     misc_feature    231..542
                     /gene="LOC106085914"
                     /note="Iron-sulfur cluster assembly accessory protein;
                     Region: TIGR00049"
                     /db_xref="CDD:272875"
     polyA_site      675
                     /gene="LOC106085914"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgacacactc agctgttatc actctaatct gataaaaaca aatacatttg ggaaaaatat
       61 tagaagaaac acaacgtcta gctaaaacaa tttatcatat ataaaataca aatactcgaa
      121 atatttaagt acaaaattgt gaaaaaccaa aaatggccac caaagtagtt gccaccgcca
      181 ctgtaagggc tttgaaagga cgtaaactct tgcctacaag ggcagcattg acattgactc
      241 cctcggcagt gcagcgtata aaagatttac tcaaaggaca accagaatat actggactaa
      301 aagttggtgt gcgacaacgt ggttgcaatg gtctttcata tacattaaat tatgcaaagg
      361 aaaaagacaa attggatgag gaggttgtac aggatggcgt tagagtttat atagatagaa
      421 aggctcagct ctcattattg ggcactgaaa tggattacgt ggaatctaag cttgccagcg
      481 aattcgtatt caacaacccc aacattaaag gcacatgcgg ttgcggtgaa tcgtttagta
      541 tataaactgt tagtctgaat tggaaaacaa atttggaggt tattattact taaggaaatc
      601 gaaggaaaga aagaaaacgt tagttaatac taaaattaga cattgtaaaa taaaatagat
      661 gggcatataa agtaa