Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250398 675 bp mRNA linear INV 02-SEP-2023 homolog, mitochondrial (LOC106085914), mRNA. ACCESSION XM_013250398 VERSION XM_013250398.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250398.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..675 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..675 /gene="LOC106085914" /note="iron-sulfur cluster assembly 1 homolog, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:106085914" CDS 153..545 /gene="LOC106085914" /codon_start=1 /product="iron-sulfur cluster assembly 1 homolog, mitochondrial" /protein_id="XP_013105852.1" /db_xref="GeneID:106085914" /translation="MATKVVATATVRALKGRKLLPTRAALTLTPSAVQRIKDLLKGQP EYTGLKVGVRQRGCNGLSYTLNYAKEKDKLDEEVVQDGVRVYIDRKAQLSLLGTEMDY VESKLASEFVFNNPNIKGTCGCGESFSI" misc_feature 231..542 /gene="LOC106085914" /note="Iron-sulfur cluster assembly accessory protein; Region: TIGR00049" /db_xref="CDD:272875" polyA_site 675 /gene="LOC106085914" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgacacactc agctgttatc actctaatct gataaaaaca aatacatttg ggaaaaatat 61 tagaagaaac acaacgtcta gctaaaacaa tttatcatat ataaaataca aatactcgaa 121 atatttaagt acaaaattgt gaaaaaccaa aaatggccac caaagtagtt gccaccgcca 181 ctgtaagggc tttgaaagga cgtaaactct tgcctacaag ggcagcattg acattgactc 241 cctcggcagt gcagcgtata aaagatttac tcaaaggaca accagaatat actggactaa 301 aagttggtgt gcgacaacgt ggttgcaatg gtctttcata tacattaaat tatgcaaagg 361 aaaaagacaa attggatgag gaggttgtac aggatggcgt tagagtttat atagatagaa 421 aggctcagct ctcattattg ggcactgaaa tggattacgt ggaatctaag cttgccagcg 481 aattcgtatt caacaacccc aacattaaag gcacatgcgg ttgcggtgaa tcgtttagta 541 tataaactgt tagtctgaat tggaaaacaa atttggaggt tattattact taaggaaatc 601 gaaggaaaga aagaaaacgt tagttaatac taaaattaga cattgtaaaa taaaatagat 661 gggcatataa agtaa