Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250326 425 bp mRNA linear INV 02-SEP-2023 (LOC106085878), mRNA. ACCESSION XM_013250326 VERSION XM_013250326.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250326.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..425 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..425 /gene="LOC106085878" /note="venom peptide MmKTx1-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085878" CDS 100..369 /gene="LOC106085878" /codon_start=1 /product="venom peptide MmKTx1-like" /protein_id="XP_013105780.2" /db_xref="GeneID:106085878" /translation="MKLYVFFTLLMVICTLAKAEVTCTIDGKSVKVGQTYQPPGQCRL YKCTNEGTFSTTDCPPVHVTHNCKLIEKDVTKPYPECCARVVCKH" polyA_site 425 /gene="LOC106085878" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atttgagttg tagtgtccat attgttgatt agttaacatt tgaattagct ataagaagct 61 ttcatatagt ctgtgtcgac tagaataaag aagggcaaaa tgaaattata cgtatttttt 121 acacttttaa tggtcatatg tactttagcc aaagctgagg ttacctgcac cattgatggc 181 aagagtgtaa aagtgggaca aacttatcag ccacctggac aatgtagact ttataaatgt 241 accaacgagg gcaccttcag caccacagat tgtcctccag tccatgtaac ccacaattgc 301 aaacttattg agaaggatgt cacaaaaccc tatcccgagt gttgtgcccg tgttgtttgc 361 aaacattaaa tagaaaacca attatgtgct gctaaacgat ccaataaaga gtaataattc 421 ttaaa