Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans venom peptide MmKTx1-like


LOCUS       XM_013250326             425 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085878), mRNA.
ACCESSION   XM_013250326
VERSION     XM_013250326.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250326.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..425
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..425
                     /gene="LOC106085878"
                     /note="venom peptide MmKTx1-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085878"
     CDS             100..369
                     /gene="LOC106085878"
                     /codon_start=1
                     /product="venom peptide MmKTx1-like"
                     /protein_id="XP_013105780.2"
                     /db_xref="GeneID:106085878"
                     /translation="MKLYVFFTLLMVICTLAKAEVTCTIDGKSVKVGQTYQPPGQCRL
                     YKCTNEGTFSTTDCPPVHVTHNCKLIEKDVTKPYPECCARVVCKH"
     polyA_site      425
                     /gene="LOC106085878"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atttgagttg tagtgtccat attgttgatt agttaacatt tgaattagct ataagaagct
       61 ttcatatagt ctgtgtcgac tagaataaag aagggcaaaa tgaaattata cgtatttttt
      121 acacttttaa tggtcatatg tactttagcc aaagctgagg ttacctgcac cattgatggc
      181 aagagtgtaa aagtgggaca aacttatcag ccacctggac aatgtagact ttataaatgt
      241 accaacgagg gcaccttcag caccacagat tgtcctccag tccatgtaac ccacaattgc
      301 aaacttattg agaaggatgt cacaaaaccc tatcccgagt gttgtgcccg tgttgtttgc
      361 aaacattaaa tagaaaacca attatgtgct gctaaacgat ccaataaaga gtaataattc
      421 ttaaa