Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans NADH dehydrogenase [ubiquinone]


LOCUS       XM_013250210             742 bp    mRNA    linear   INV 02-SEP-2023
            iron-sulfur protein 4, mitochondrial (LOC106085793), mRNA.
ACCESSION   XM_013250210
VERSION     XM_013250210.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250210.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..742
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..742
                     /gene="LOC106085793"
                     /note="NADH dehydrogenase [ubiquinone] iron-sulfur protein
                     4, mitochondrial; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 11 Proteins"
                     /db_xref="GeneID:106085793"
     CDS             86..628
                     /gene="LOC106085793"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] iron-sulfur
                     protein 4, mitochondrial"
                     /protein_id="XP_013105664.1"
                     /db_xref="GeneID:106085793"
                     /translation="MSFLVRQIVQATKNTQQWSPVLSRGMASLRDTPVIDVDTALAKP
                     EDIEQKNKLQGTITVPVKVDLSPISGVPEEQVKTRRVRIYMPPKNAMQSGTNNLHTWQ
                     IDFDNRERWENPLMGWSSTGDPLSNMQVNFTSPEEAITYCERNGWRWFVERPDVPKTD
                     RVKNYGVNFSWNRRTRVSTK"
     misc_feature    323..601
                     /gene="LOC106085793"
                     /note="NADH dehydrogenase ubiquinone Fe-S protein 4;
                     Region: NDUS4; pfam04800"
                     /db_xref="CDD:461433"
     polyA_site      742
                     /gene="LOC106085793"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccatatgttt atgacaatct actaaattgg tgtaggatca attttatgta ataacatcgt
       61 tcgaatcgca aaattgttta gaaaaatgtc ttttttggtg cggcaaattg tccaagctac
      121 caaaaatacc cagcaatggt cccctgtact gagccgtggt atggcctcgt tgcgtgacac
      181 tccagtcata gatgtggata ctgctttagc caaacccgag gatattgaac aaaagaacaa
      241 gttgcaaggc accattaccg tgcctgtcaa agtggacctt agccccattt cgggagtgcc
      301 agaggaacaa gtaaaaactc gccgtgttcg catctatatg ccaccaaaga acgccatgca
      361 aagcggcacc aataacttgc atacttggca aattgatttt gataaccgtg aacgttggga
      421 aaatcccttg atgggctgga gttctactgg cgatccattg tcgaacatgc aagtcaattt
      481 tacttccccc gaagaggcaa ttacctattg cgaaaggaat ggctggcgtt ggtttgttga
      541 acgccccgat gtacccaaaa ctgatcgcgt taaaaactat ggtgttaact tttcatggaa
      601 taggcgtaca cgcgtttcca ccaagtagaa ctttggcgat atattaaaag tatagatgtt
      661 tgaaatcaat tcaatgtggt taaataatat agcaaaatgc ggattcgaga ccatggagtt
      721 acaataaaaa agagaaaatg ta