Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250210 742 bp mRNA linear INV 02-SEP-2023 iron-sulfur protein 4, mitochondrial (LOC106085793), mRNA. ACCESSION XM_013250210 VERSION XM_013250210.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250210.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..742 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..742 /gene="LOC106085793" /note="NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106085793" CDS 86..628 /gene="LOC106085793" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial" /protein_id="XP_013105664.1" /db_xref="GeneID:106085793" /translation="MSFLVRQIVQATKNTQQWSPVLSRGMASLRDTPVIDVDTALAKP EDIEQKNKLQGTITVPVKVDLSPISGVPEEQVKTRRVRIYMPPKNAMQSGTNNLHTWQ IDFDNRERWENPLMGWSSTGDPLSNMQVNFTSPEEAITYCERNGWRWFVERPDVPKTD RVKNYGVNFSWNRRTRVSTK" misc_feature 323..601 /gene="LOC106085793" /note="NADH dehydrogenase ubiquinone Fe-S protein 4; Region: NDUS4; pfam04800" /db_xref="CDD:461433" polyA_site 742 /gene="LOC106085793" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccatatgttt atgacaatct actaaattgg tgtaggatca attttatgta ataacatcgt 61 tcgaatcgca aaattgttta gaaaaatgtc ttttttggtg cggcaaattg tccaagctac 121 caaaaatacc cagcaatggt cccctgtact gagccgtggt atggcctcgt tgcgtgacac 181 tccagtcata gatgtggata ctgctttagc caaacccgag gatattgaac aaaagaacaa 241 gttgcaaggc accattaccg tgcctgtcaa agtggacctt agccccattt cgggagtgcc 301 agaggaacaa gtaaaaactc gccgtgttcg catctatatg ccaccaaaga acgccatgca 361 aagcggcacc aataacttgc atacttggca aattgatttt gataaccgtg aacgttggga 421 aaatcccttg atgggctgga gttctactgg cgatccattg tcgaacatgc aagtcaattt 481 tacttccccc gaagaggcaa ttacctattg cgaaaggaat ggctggcgtt ggtttgttga 541 acgccccgat gtacccaaaa ctgatcgcgt taaaaactat ggtgttaact tttcatggaa 601 taggcgtaca cgcgtttcca ccaagtagaa ctttggcgat atattaaaag tatagatgtt 661 tgaaatcaat tcaatgtggt taaataatat agcaaaatgc ggattcgaga ccatggagtt 721 acaataaaaa agagaaaatg ta