Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250179 764 bp mRNA linear INV 02-SEP-2023 (LOC106085771), mRNA. ACCESSION XM_013250179 VERSION XM_013250179.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250179.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..764 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..764 /gene="LOC106085771" /note="uncharacterized LOC106085771; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085771" CDS 22..576 /gene="LOC106085771" /codon_start=1 /product="uncharacterized protein LOC106085771" /protein_id="XP_013105633.2" /db_xref="GeneID:106085771" /translation="MQKQWINCITILTTVLLALLLLPAVKGGVNAAPQGRELYAKVEE GEITEEIKPPTKQANEEKKHLVKKKEIIKVTITKTKEEQEEGHNGDIQDKILEVEITE PSETTRKCSEIESNCDPLVLASPQGKNHKLRARQTADDTDTSPIEDLVGTLLRQRDDF IAASGMAESPRPVEVVRANMNSGL" ORIGIN 1 ttcataactc taacactaaa gatgcagaaa cagtggataa attgcattac aatcctgacg 61 acagtgctgt tggccctgct attgttgccc gcagtcaagg gaggagtcaa tgcagcacct 121 cagggccgag aattgtatgc caaggtggaa gagggagaaa tcacagagga aattaaacca 181 ccaaccaaac aagcaaatga ggaaaagaag catttggtga agaaaaagga gataataaaa 241 gtcaccatta ccaagacaaa ggaggagcaa gaagagggcc ataatggtga tatacaagac 301 aaaatactgg aagtagaaat taccgaacct tctgaaacca ccagaaaatg ctcggagatt 361 gaaagcaact gcgatccttt ggtcttggca tcacctcaag gaaaaaatca taaattaagg 421 gcaagacaaa cagctgatga caccgatacc tcacctattg aggatttggt aggcactctt 481 ctaaggcaac gcgatgattt tatagcagca tctggcatgg ctgaatcacc acgccccgtg 541 gaagttgtga gagcgaatat gaatagtggc ttgtaatggt ttcaagtgat ataaacaaaa 601 tgggaggtga agaaactcaa aagaaatgtt taccatagat aagaatagaa caaacagaac 661 aaaaatatac agcaagatgt tacttacaaa gaaaattttt ttattcaaag tgatataata 721 atctcaagta aacaaattcc agttgcaagg caaagtggat taag