Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085771


LOCUS       XM_013250179             764 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085771), mRNA.
ACCESSION   XM_013250179
VERSION     XM_013250179.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250179.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..764
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..764
                     /gene="LOC106085771"
                     /note="uncharacterized LOC106085771; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085771"
     CDS             22..576
                     /gene="LOC106085771"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085771"
                     /protein_id="XP_013105633.2"
                     /db_xref="GeneID:106085771"
                     /translation="MQKQWINCITILTTVLLALLLLPAVKGGVNAAPQGRELYAKVEE
                     GEITEEIKPPTKQANEEKKHLVKKKEIIKVTITKTKEEQEEGHNGDIQDKILEVEITE
                     PSETTRKCSEIESNCDPLVLASPQGKNHKLRARQTADDTDTSPIEDLVGTLLRQRDDF
                     IAASGMAESPRPVEVVRANMNSGL"
ORIGIN      
        1 ttcataactc taacactaaa gatgcagaaa cagtggataa attgcattac aatcctgacg
       61 acagtgctgt tggccctgct attgttgccc gcagtcaagg gaggagtcaa tgcagcacct
      121 cagggccgag aattgtatgc caaggtggaa gagggagaaa tcacagagga aattaaacca
      181 ccaaccaaac aagcaaatga ggaaaagaag catttggtga agaaaaagga gataataaaa
      241 gtcaccatta ccaagacaaa ggaggagcaa gaagagggcc ataatggtga tatacaagac
      301 aaaatactgg aagtagaaat taccgaacct tctgaaacca ccagaaaatg ctcggagatt
      361 gaaagcaact gcgatccttt ggtcttggca tcacctcaag gaaaaaatca taaattaagg
      421 gcaagacaaa cagctgatga caccgatacc tcacctattg aggatttggt aggcactctt
      481 ctaaggcaac gcgatgattt tatagcagca tctggcatgg ctgaatcacc acgccccgtg
      541 gaagttgtga gagcgaatat gaatagtggc ttgtaatggt ttcaagtgat ataaacaaaa
      601 tgggaggtga agaaactcaa aagaaatgtt taccatagat aagaatagaa caaacagaac
      661 aaaaatatac agcaagatgt tacttacaaa gaaaattttt ttattcaaag tgatataata
      721 atctcaagta aacaaattcc agttgcaagg caaagtggat taag