Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans glucose dehydrogenase [FAD, quinone]


LOCUS       XM_013250161            2186 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085757), mRNA.
ACCESSION   XM_013250161
VERSION     XM_013250161.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250161.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2186
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..2186
                     /gene="LOC106085757"
                     /note="glucose dehydrogenase [FAD, quinone]; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 78 Proteins"
                     /db_xref="GeneID:106085757"
     CDS             161..2050
                     /gene="LOC106085757"
                     /codon_start=1
                     /product="glucose dehydrogenase [FAD, quinone]"
                     /protein_id="XP_013105615.2"
                     /db_xref="GeneID:106085757"
                     /translation="MVFNLLFITTVIKSTFGVVTTGLWLIPLLLATITYYKYDQVDPE
                     ARAFDHQDLYADYDFIVVGAGSAGAVVANRLSEVHKWKVLLLEAGPDENEISDVPSLA
                     AYLQLSKLDWQYKTAPSNKSCLGMKNNRCNWPRGKVLGGSSVLNYMLYVRGNRHDYDH
                     WESLGNEGWGYDNVLHYFKKSEDNRNPYLSGNAYHGSGGYLTVQESPWHTPLVAAFVE
                     AGTELGYENRDINGETQTGFMIAQGTIRRGSRCSTAKAFLRPIRQRKNFHLSLNSQVT
                     KVIIDESNMRVKGVEFVKYGQVRRVYAKREVILSAGALNTPQIMMLSGIGPRQHLEAH
                     GIKVLQDLPVGENMQDHVGMGGLTFLVDKPVAIVQDRFNPTGITLQYVLRERGPMTTL
                     GGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVMGLKESLYQEVYHPI
                     GNKDSWSIIPLLLRPRSRGWVRLRSANPFVYPIIDANYFDDPLDVKVLVEGAKIALRV
                     AEAKVFKQFGSRLYQKPLPNCKKFRFMSDAYIECHIRTISMTIYHPCGTAKMGPAWDE
                     EAVVDPRLRVYGIRGLRVIDASIMPTISSGNTNAPVIMIGEKGADLIKEDWFHNPEYR
                     VNEKS"
ORIGIN      
        1 gctgctaagg cgatttacta caatgagtaa acgcaaaaaa ttttgcagaa aataaaacaa
       61 aaaaattgca cacaacatta aaactgcaac aaacaacaac tgaactcaaa acaactccga
      121 taaaaaaaag ttttctcttc cctttccatt ccccaccaaa atggtcttca atttgctgtt
      181 cataacaact gtgataaaat ccacatttgg tgtggtaacc actggcctgt ggcttatacc
      241 cctgctgctg gccaccataa cctattacaa atacgatcag gtagatccag aagcgagagc
      301 gtttgatcat caggacctct atgccgatta tgatttcata gttgtgggtg cgggttcagc
      361 aggagctgtg gtggccaatc gtttgagtga agtacacaaa tggaaggtgc tgctgttgga
      421 ggcggggccc gatgaaaacg aaatatccga tgtgccctcc ttggcggcct atttgcaact
      481 gagtaaattg gattggcaat ataagacggc gccttccaac aaatcctgcc tgggcatgaa
      541 aaataatcgc tgcaattggc ctcgaggcaa ggtgctaggt ggctccagtg tcttgaatta
      601 tatgctctat gtgaggggca atcgccatga ctatgatcac tgggaatctt tgggcaacga
      661 aggctggggc tatgataacg tcttgcatta tttcaaaaag tccgaggata atcgaaatcc
      721 ctatttgagc ggcaatgcct atcatggctc tggagggtat ttgacggtgc aagaatctcc
      781 ctggcatact cctttggtgg ctgcttttgt agaggccggc actgagttgg gttatgaaaa
      841 tcgcgacatt aatggggaaa cgcaaaccgg cttcatgata gcccagggca ccatacgcag
      901 gggatcacgt tgcagtacgg ccaaggcttt tctaagaccc ataaggcaga ggaaaaattt
      961 ccatttgtcc ttgaactcac aggtgaccaa ggtgattata gatgagtcaa acatgagggt
     1021 taagggagtg gaatttgtca aatatggcca ggtgagaagg gtgtatgcca agcgagaggt
     1081 catattgtca gcaggggccc ttaacacccc ccagataatg atgctgtcgg gcataggccc
     1141 ccgccagcat ttggaggcgc atggtattaa ggttctgcaa gatctaccgg tgggggagaa
     1201 tatgcaggat catgtgggca tgggaggttt gacattcctg gtggataagc cagtggccat
     1261 agtgcaggat cgcttcaatc ccaccggcat cacattgcaa tatgtgttgc gtgagcgggg
     1321 acccatgacc actttgggtg gggtagaggg tttggctttt gtacacaccc cctattcgaa
     1381 tcgcagtcta gattggccag atatacaatt tcacatggcg ccggcttcca taaactccga
     1441 taatggggcc cgagttaaga aggttatggg ccttaaggag tctttgtatc aggaagttta
     1501 ccatcccata ggtaataagg attcctggag tattatccct ttgctgctga gacctcgctc
     1561 tagaggttgg gtaagattgc gttctgcaaa tccttttgtt tatcccatca tagatgccaa
     1621 ttactttgat gatcctttgg atgttaaggt gttggtggag ggagccaaaa tagccttgag
     1681 ggtggccgaa gccaaggttt tcaaacaatt tggctctcgt ctctatcaaa agcctttgcc
     1741 caattgcaaa aaattccgtt tcatgtctga tgcgtacata gagtgccaca tacgcaccat
     1801 atccatgacg atatatcatc cttgtggcac agccaaaatg ggtcctgcct gggacgagga
     1861 agcagtggtg gatccccgcc taagggtcta tggcattcga ggacttaggg ttattgatgc
     1921 cagcataatg cccaccatta gcagtggcaa taccaatgcc cccgtcataa tgattggtga
     1981 aaagggggca gatttaataa aagaggattg gtttcataat cccgagtatc gagtcaatga
     2041 gaagagttag cattgcaagt ggaaaactac caaagtttgt ccatagataa tttgtagaga
     2101 cttaaaactg ccaaaactca agcgattcat accattcagg gggcttttag ctttagctct
     2161 ttttaacaga gttgccatgt gtgtca