Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250128 941 bp mRNA linear INV 02-SEP-2023 dioxygenase alkB homolog 7, mitochondrial (LOC106085737), transcript variant X2, mRNA. ACCESSION XM_013250128 VERSION XM_013250128.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250128.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..941 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..941 /gene="LOC106085737" /note="alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106085737" CDS 18..770 /gene="LOC106085737" /codon_start=1 /product="alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial isoform X2" /protein_id="XP_013105582.2" /db_xref="GeneID:106085737" /translation="MAALSRSSLFVFVKNGSGFARIGGKSLVSVPSLNNVLRGFSNRP EKSPIVPSLLDFRGEWLAADKEKFQCDMKVLVDFITVEEETKLLEEIEPYMKRLRYEF DHWDDAIHGFRETERKHWYPHNRQVLERVRVEGFQEEIMPYIHILDLAAEGVIKPHID STRYCGHTIAGISLLSDSVMRLVYATHKVEQSDDYRSQPKAILENNFYADILLPRRSL YIMRMLSMSSYEELLLQKAFYAQKERNCFHIT" ORIGIN 1 catatgactt cgctgaaatg gcggcacttt ctcgtagttc tttatttgta tttgttaaaa 61 atggaagcgg tttcgcgaga attggcggaa aaagcttggt ttccgttcca agcctgaata 121 atgttttgcg cggatttagc aatagaccgg aaaaaagtcc catagttccc agtttattgg 181 attttcgagg cgaatggcta gctgcagaca aagagaagtt ccaatgtgat atgaaagttt 241 tggttgactt cataaccgta gaagaagaaa ccaaacttct agaggaaatt gagccctata 301 tgaaacgttt gcgttatgag tttgatcatt gggatgatgc cattcatggc tttagagaaa 361 ctgaacgcaa acattggtat cctcacaatc gacaggtttt ggaaagagtg cgagtagagg 421 gtttccaaga ggaaattatg ccttacatac acatattgga tttggctgct gaaggtgtaa 481 taaaacctca catagacagt acaaggtatt gtggccatac tatagccggc ataagtctac 541 tctctgactc ggtaatgcgt ttggtctatg ccacccataa agtcgagcaa tccgacgatt 601 atcgcagcca gcccaaagcc atattagaaa ataacttcta tgcagatatt cttctgccgc 661 gtagatcttt atatataatg agaatgttat caatgagcag ttatgaggag ttattgttac 721 aaaaggcgtt ctatgcacaa aaggaaagaa attgctttca tataacctga acagcaggat 781 gtcattgttg tgagagcata atttcggggt atgggaaaac ttacctaaat atgaaaatga 841 acagcaccag gagggagaag aacacagcca cattgtccat ggtgcgcagc atgacgaata 901 attggcgtct caaattgggc atgaagcgta cgagcttgag g