Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-ketoglutarate-dependent


LOCUS       XM_013250126             857 bp    mRNA    linear   INV 02-SEP-2023
            dioxygenase alkB homolog 7, mitochondrial (LOC106085737),
            transcript variant X1, mRNA.
ACCESSION   XM_013250126
VERSION     XM_013250126.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250126.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..857
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..857
                     /gene="LOC106085737"
                     /note="alpha-ketoglutarate-dependent dioxygenase alkB
                     homolog 7, mitochondrial; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106085737"
     CDS             18..800
                     /gene="LOC106085737"
                     /codon_start=1
                     /product="alpha-ketoglutarate-dependent dioxygenase alkB
                     homolog 7, mitochondrial isoform X1"
                     /protein_id="XP_013105580.2"
                     /db_xref="GeneID:106085737"
                     /translation="MAALSRSSLFVFVKNGSGFARIGGKSLVSVPSLNNVLRGFSNRP
                     EKSPIVPSLLDFRGEWLAADKEKFQCDMKVLVDFITVEEETKLLEEIEPYMKRLRYEF
                     DHWDDAIHGFRETERKHWYPHNRQVLERVRVEGFQEEIMPYIHILDLAAEGVIKPHID
                     STRYCGHTIAGISLLSDSVMRLVYATHKVEQSDDYRSQPKAILENNFYADILLPRRSL
                     YIMSHYARYDFTHEILANQQSCFMGQPVKKDRRLSIICRNEP"
ORIGIN      
        1 catatgactt cgctgaaatg gcggcacttt ctcgtagttc tttatttgta tttgttaaaa
       61 atggaagcgg tttcgcgaga attggcggaa aaagcttggt ttccgttcca agcctgaata
      121 atgttttgcg cggatttagc aatagaccgg aaaaaagtcc catagttccc agtttattgg
      181 attttcgagg cgaatggcta gctgcagaca aagagaagtt ccaatgtgat atgaaagttt
      241 tggttgactt cataaccgta gaagaagaaa ccaaacttct agaggaaatt gagccctata
      301 tgaaacgttt gcgttatgag tttgatcatt gggatgatgc cattcatggc tttagagaaa
      361 ctgaacgcaa acattggtat cctcacaatc gacaggtttt ggaaagagtg cgagtagagg
      421 gtttccaaga ggaaattatg ccttacatac acatattgga tttggctgct gaaggtgtaa
      481 taaaacctca catagacagt acaaggtatt gtggccatac tatagccggc ataagtctac
      541 tctctgactc ggtaatgcgt ttggtctatg ccacccataa agtcgagcaa tccgacgatt
      601 atcgcagcca gcccaaagcc atattagaaa ataacttcta tgcagatatt cttctgccgc
      661 gtagatcttt atatataatg agtcactatg cccgttatga cttcacccat gagattttgg
      721 ccaaccaaca gtcgtgtttt atgggacagc cggtgaaaaa agaccgacgc ctatcgatta
      781 tttgccgaaa tgagccctaa catagtgtcg agggcggtgt attgttaaca ggtgtgcctg
      841 gttgaatgaa aaaaaaa