Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250084 452 bp mRNA linear INV 02-SEP-2023 (LOC106085714), mRNA. ACCESSION XM_013250084 VERSION XM_013250084.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250084.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..452 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..452 /gene="LOC106085714" /note="uncharacterized LOC106085714; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085714" CDS 40..372 /gene="LOC106085714" /codon_start=1 /product="uncharacterized protein LOC106085714" /protein_id="XP_013105538.1" /db_xref="GeneID:106085714" /translation="MNENEVKNITKDFRDIFCNNKKKQTCELLNLYEGITCECMHKSR IQEVQGRITWFQRMVCFYQLVLAFFGLIITLAAYGFWLSSQYTRSTIYSTCATSFFWP YTSCPLAY" polyA_site 452 /gene="LOC106085714" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attttttact gtcacaattt ttaaatttga actttaataa tgaatgaaaa tgaagtcaaa 61 aatataacta aagattttcg tgatatattt tgcaataaca agaagaaaca gacatgtgaa 121 cttcttaatt tgtatgaagg catcacttgc gaatgtatgc acaaatcacg aatacaagaa 181 gtgcaaggca gaattacgtg gttccaaagg atggtgtgtt tctaccagtt ggtcttggcc 241 ttttttggtc tgataataac cttagccgca tatggatttt ggctaagtag tcaatacacc 301 agatcaacca tttatagcac ctgcgccact tcattctttt ggccatatac tagttgtcca 361 ctggcctatt agccaattac gatatattta tgtatttata gatttatttt tcttcatatt 421 tttagtaaat tttttatcta gtgaaagtaa aa