Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085714


LOCUS       XM_013250084             452 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085714), mRNA.
ACCESSION   XM_013250084
VERSION     XM_013250084.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250084.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..452
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..452
                     /gene="LOC106085714"
                     /note="uncharacterized LOC106085714; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085714"
     CDS             40..372
                     /gene="LOC106085714"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085714"
                     /protein_id="XP_013105538.1"
                     /db_xref="GeneID:106085714"
                     /translation="MNENEVKNITKDFRDIFCNNKKKQTCELLNLYEGITCECMHKSR
                     IQEVQGRITWFQRMVCFYQLVLAFFGLIITLAAYGFWLSSQYTRSTIYSTCATSFFWP
                     YTSCPLAY"
     polyA_site      452
                     /gene="LOC106085714"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attttttact gtcacaattt ttaaatttga actttaataa tgaatgaaaa tgaagtcaaa
       61 aatataacta aagattttcg tgatatattt tgcaataaca agaagaaaca gacatgtgaa
      121 cttcttaatt tgtatgaagg catcacttgc gaatgtatgc acaaatcacg aatacaagaa
      181 gtgcaaggca gaattacgtg gttccaaagg atggtgtgtt tctaccagtt ggtcttggcc
      241 ttttttggtc tgataataac cttagccgca tatggatttt ggctaagtag tcaatacacc
      301 agatcaacca tttatagcac ctgcgccact tcattctttt ggccatatac tagttgtcca
      361 ctggcctatt agccaattac gatatattta tgtatttata gatttatttt tcttcatatt
      421 tttagtaaat tttttatcta gtgaaagtaa aa