Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250082 1134 bp mRNA linear INV 02-SEP-2023 (LOC106085712), mRNA. ACCESSION XM_013250082 VERSION XM_013250082.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250082.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1134 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1134 /gene="LOC106085712" /note="S-phase kinase-associated protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 34 Proteins" /db_xref="GeneID:106085712" CDS 216..704 /gene="LOC106085712" /codon_start=1 /product="S-phase kinase-associated protein 1" /protein_id="XP_013105536.1" /db_xref="GeneID:106085712" /translation="MPNIKLQSSDDEIFDTDVQIAKCSGTIKTMLEDCGMEDGDNAVV PLPNVNSAILRKVLHWANYHKDDPQPPEDDENKEKRTDDISSWDADFLKVDQGTLFEL ILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTPAEEEQVRKENEWCE EK" misc_feature 222..593 /gene="LOC106085712" /note="BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ (poxvirus and zinc finger) domain found in S-phase kinase-associated protein 1 (SKP1) and similar proteins; Region: BTB_POZ_SKP1; cd18322" /db_xref="CDD:349631" misc_feature order(288..293,303..305,315..317,327..329,339..344, 348..350,354..359,525..527,534..539,543..545) /gene="LOC106085712" /note="cullin binding site [polypeptide binding]; other site" /db_xref="CDD:349631" misc_feature order(501..503,513..515,525..527,534..536,549..551, 561..563,570..575,579..584,591..593) /gene="LOC106085712" /note="F-box protein binding site [polypeptide binding]; other site" /db_xref="CDD:349631" misc_feature 549..692 /gene="LOC106085712" /note="Skp1 family, dimerization domain; Region: Skp1; pfam01466" /db_xref="CDD:460222" polyA_site 1134 /gene="LOC106085712" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccaattgtgt tcgttgttca gagctgcaca gctacaaatt caccgaagaa gatacagagt 61 aagcagtgtg aatcattttc tttttattta agaaaattga taatcccaaa gcagacttac 121 tgattttgaa acgcaataga ttgaaagtcg gtaacaacaa atagcttttg tttaatcaaa 181 caaaaaaaaa aagaaaacaa caacaacagt caaaaatgcc caatatcaag ttgcagtcat 241 cggacgatga aatattcgac actgatgtac aaatagccaa atgttctggc accataaaaa 301 ctatgttgga agattgtggc atggaagatg gagacaatgc cgtagtgcct ctgcccaatg 361 tcaattcggc catattgcgc aaagttttac attgggccaa ttatcacaag gacgaccccc 421 aaccaccaga ggatgatgag aacaaagaaa aacgcacaga cgacatttcc tcgtgggatg 481 ccgatttcct taaggtggac caaggtaccc tattcgaatt gattttagcc gccaattatc 541 tggacatcaa gggcctcctc gatgtcacat gcaaaacagt agccaacatg atcaaaggca 601 aaacacccga ggagatacgc aagacattta atatcaaaaa tgatttcacc ccagctgaag 661 aggaacaagt gcgcaaggag aacgaatggt gcgaggagaa gtaaaccatg gagtatatta 721 agcagggaca gaaaaaaatt aaccaaacgt atataatata cacacatata aaacaacaac 781 acactactta ctaatggaat acctaagatg ctatgttgtc ttactacatg tgaacgattt 841 tgttttgtac tattaaactg tcactaaaat acaaataact actttaatgt tctataaatt 901 caatatgaat attgcagtcg ttttacactc aattttcccc cttttcacac gtacgtattg 961 attaagcagt ttgttattga actcactatg atggaatcaa tagccgcaga agaaaagaaa 1021 accaactctg tttagttctt tttacatata gaattttatt tttgtcttta cgtcgctaca 1081 taaatgctat tacataaatt acttcgattt taaaataaat ggattcgttt ttaa