Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans S-phase kinase-associated protein 1


LOCUS       XM_013250082            1134 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085712), mRNA.
ACCESSION   XM_013250082
VERSION     XM_013250082.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250082.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1134
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1134
                     /gene="LOC106085712"
                     /note="S-phase kinase-associated protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 34 Proteins"
                     /db_xref="GeneID:106085712"
     CDS             216..704
                     /gene="LOC106085712"
                     /codon_start=1
                     /product="S-phase kinase-associated protein 1"
                     /protein_id="XP_013105536.1"
                     /db_xref="GeneID:106085712"
                     /translation="MPNIKLQSSDDEIFDTDVQIAKCSGTIKTMLEDCGMEDGDNAVV
                     PLPNVNSAILRKVLHWANYHKDDPQPPEDDENKEKRTDDISSWDADFLKVDQGTLFEL
                     ILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTPAEEEQVRKENEWCE
                     EK"
     misc_feature    222..593
                     /gene="LOC106085712"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac) /POZ
                     (poxvirus and zinc finger) domain found in S-phase
                     kinase-associated protein 1 (SKP1) and similar proteins;
                     Region: BTB_POZ_SKP1; cd18322"
                     /db_xref="CDD:349631"
     misc_feature    order(288..293,303..305,315..317,327..329,339..344,
                     348..350,354..359,525..527,534..539,543..545)
                     /gene="LOC106085712"
                     /note="cullin binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:349631"
     misc_feature    order(501..503,513..515,525..527,534..536,549..551,
                     561..563,570..575,579..584,591..593)
                     /gene="LOC106085712"
                     /note="F-box protein binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:349631"
     misc_feature    549..692
                     /gene="LOC106085712"
                     /note="Skp1 family, dimerization domain; Region: Skp1;
                     pfam01466"
                     /db_xref="CDD:460222"
     polyA_site      1134
                     /gene="LOC106085712"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccaattgtgt tcgttgttca gagctgcaca gctacaaatt caccgaagaa gatacagagt
       61 aagcagtgtg aatcattttc tttttattta agaaaattga taatcccaaa gcagacttac
      121 tgattttgaa acgcaataga ttgaaagtcg gtaacaacaa atagcttttg tttaatcaaa
      181 caaaaaaaaa aagaaaacaa caacaacagt caaaaatgcc caatatcaag ttgcagtcat
      241 cggacgatga aatattcgac actgatgtac aaatagccaa atgttctggc accataaaaa
      301 ctatgttgga agattgtggc atggaagatg gagacaatgc cgtagtgcct ctgcccaatg
      361 tcaattcggc catattgcgc aaagttttac attgggccaa ttatcacaag gacgaccccc
      421 aaccaccaga ggatgatgag aacaaagaaa aacgcacaga cgacatttcc tcgtgggatg
      481 ccgatttcct taaggtggac caaggtaccc tattcgaatt gattttagcc gccaattatc
      541 tggacatcaa gggcctcctc gatgtcacat gcaaaacagt agccaacatg atcaaaggca
      601 aaacacccga ggagatacgc aagacattta atatcaaaaa tgatttcacc ccagctgaag
      661 aggaacaagt gcgcaaggag aacgaatggt gcgaggagaa gtaaaccatg gagtatatta
      721 agcagggaca gaaaaaaatt aaccaaacgt atataatata cacacatata aaacaacaac
      781 acactactta ctaatggaat acctaagatg ctatgttgtc ttactacatg tgaacgattt
      841 tgttttgtac tattaaactg tcactaaaat acaaataact actttaatgt tctataaatt
      901 caatatgaat attgcagtcg ttttacactc aattttcccc cttttcacac gtacgtattg
      961 attaagcagt ttgttattga actcactatg atggaatcaa tagccgcaga agaaaagaaa
     1021 accaactctg tttagttctt tttacatata gaattttatt tttgtcttta cgtcgctaca
     1081 taaatgctat tacataaatt acttcgattt taaaataaat ggattcgttt ttaa