Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like


LOCUS       XM_013250044             793 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085693), mRNA.
ACCESSION   XM_013250044
VERSION     XM_013250044.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250044.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 2% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..793
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..793
                     /gene="LOC106085693"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 12 Proteins"
                     /db_xref="GeneID:106085693"
     CDS             8..793
                     /gene="LOC106085693"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013105498.2"
                     /db_xref="GeneID:106085693"
                     /translation="MKRFLSFLSIICIIGLAKSTDYCNPNLCKKGAHIACGHSGKFHS
                     SCPANAVLFNITQSFKDFLIKYHNEKRNYIAGGNDAHHDAACQMGTVQWDDELAYLAH
                     FNVLQCKMEHDACHNTAKYHSSGQNLAIRWYNGTPDIKKSFQKGVDSWFNEVQYSNMD
                     FINSYRRNNEHAIGHFTAMMVQNNVRIGCAAATYGAKDPKGKQYFLLACNYDNTNWNG
                     NPIYASCSKPAAACTTGTNPDYPNLCSLKEHYDFNAKNPKIKA"
ORIGIN      
        1 gagaaaaatg aagcgatttt tatcattttt gagtataatt tgtataatag gattagccaa
       61 gtccacagat tattgtaatc ctaatctatg caaaaaagga gctcatattg cttgtgggca
      121 tagtggaaaa tttcattcct cttgtcctgc caatgctgtc ctattcaaca tcacccagtc
      181 ctttaaggac ttccttatca agtatcacaa tgaaaaacgc aattatatag ccggtggcaa
      241 tgatgcccat catgatgctg cctgccaaat gggaaccgta caatgggatg atgaattggc
      301 ctacctggcc catttcaatg tcctccaatg taaaatggaa catgatgctt gtcataacac
      361 cgccaaatat cattcgtctg gacaaaattt ggccataaga tggtataatg gcacaccaga
      421 tattaagaaa agtttccaaa aaggtgtcga ttcatggttc aatgaggtgc agtacagtaa
      481 catggatttc atcaactcct atcggcgcaa caacgagcat gcaattggtc atttcaccgc
      541 tatgatggta cagaacaatg tacgcatagg atgtgccgct gccacctatg gagctaagga
      601 tcccaagggg aagcaatact ttttgttggc atgcaattat gacaacacta actggaatgg
      661 caatcccatc tatgcgagct gcagtaaacc agctgctgcc tgtaccacag gtaccaatcc
      721 agactatccc aatttgtgtt ctctcaagga acattatgat tttaatgcaa aaaatccaaa
      781 aataaaagca taa