Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250044 793 bp mRNA linear INV 02-SEP-2023 (LOC106085693), mRNA. ACCESSION XM_013250044 VERSION XM_013250044.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250044.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 2% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..793 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..793 /gene="LOC106085693" /note="antigen 5 like allergen Cul n 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106085693" CDS 8..793 /gene="LOC106085693" /codon_start=1 /product="antigen 5 like allergen Cul n 1-like" /protein_id="XP_013105498.2" /db_xref="GeneID:106085693" /translation="MKRFLSFLSIICIIGLAKSTDYCNPNLCKKGAHIACGHSGKFHS SCPANAVLFNITQSFKDFLIKYHNEKRNYIAGGNDAHHDAACQMGTVQWDDELAYLAH FNVLQCKMEHDACHNTAKYHSSGQNLAIRWYNGTPDIKKSFQKGVDSWFNEVQYSNMD FINSYRRNNEHAIGHFTAMMVQNNVRIGCAAATYGAKDPKGKQYFLLACNYDNTNWNG NPIYASCSKPAAACTTGTNPDYPNLCSLKEHYDFNAKNPKIKA" ORIGIN 1 gagaaaaatg aagcgatttt tatcattttt gagtataatt tgtataatag gattagccaa 61 gtccacagat tattgtaatc ctaatctatg caaaaaagga gctcatattg cttgtgggca 121 tagtggaaaa tttcattcct cttgtcctgc caatgctgtc ctattcaaca tcacccagtc 181 ctttaaggac ttccttatca agtatcacaa tgaaaaacgc aattatatag ccggtggcaa 241 tgatgcccat catgatgctg cctgccaaat gggaaccgta caatgggatg atgaattggc 301 ctacctggcc catttcaatg tcctccaatg taaaatggaa catgatgctt gtcataacac 361 cgccaaatat cattcgtctg gacaaaattt ggccataaga tggtataatg gcacaccaga 421 tattaagaaa agtttccaaa aaggtgtcga ttcatggttc aatgaggtgc agtacagtaa 481 catggatttc atcaactcct atcggcgcaa caacgagcat gcaattggtc atttcaccgc 541 tatgatggta cagaacaatg tacgcatagg atgtgccgct gccacctatg gagctaagga 601 tcccaagggg aagcaatact ttttgttggc atgcaattat gacaacacta actggaatgg 661 caatcccatc tatgcgagct gcagtaaacc agctgctgcc tgtaccacag gtaccaatcc 721 agactatccc aatttgtgtt ctctcaagga acattatgat tttaatgcaa aaaatccaaa 781 aataaaagca taa