Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1


LOCUS       XM_013250040             834 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085691), mRNA.
ACCESSION   XM_013250040
VERSION     XM_013250040.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250040.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..834
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..834
                     /gene="LOC106085691"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 25 Proteins"
                     /db_xref="GeneID:106085691"
     CDS             37..801
                     /gene="LOC106085691"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_013105494.2"
                     /db_xref="GeneID:106085691"
                     /translation="MKQIFAFLGLICMLGLAKSTDYCDPKLCSEGTHIACGHSGEFAA
                     SCPANAEIFNITEPFKDFLLKYHNEKRNYIAGGNDPNHDAACHMGTMQWDDELAALAH
                     YNVLQCKMEHDDCHDTLDYHASGQNLAERWYTGAPNMDKLFQQSVDMWYNEVQYSNRD
                     YIKSYKRNKEHAIGHFTVMMYQNNVRMGCAAAKYGDENPKNKQYFLLACNYANTNWVG
                     WPIYNSCSEPATACTTGTNPDYPNLCSLEEYYDFNA"
ORIGIN      
        1 ggactaattt ctctaacaca gctggcaaga aaagaaatga agcaaatttt tgcatttttg
       61 ggtcttatct gtatgctagg tttggccaag tctacggatt attgcgatcc taagctatgc
      121 tcggagggaa ctcatattgc atgtggccat agtggagaat ttgctgcttc gtgccctgcc
      181 aatgctgaaa tatttaacat caccgagccc tttaaagact ttcttctgaa gtatcacaat
      241 gagaaacgca attacatagc cgggggcaat gatcccaatc acgatgcagc ttgccacatg
      301 ggtaccatgc aatgggacga tgaattggcc gctttggccc attacaatgt gcttcaatgc
      361 aaaatggaac atgacgattg tcatgacact ttggactatc atgcgtctgg acaaaatttg
      421 gccgaaagat ggtatacagg tgctccaaat atggataaat tgttccagca atccgttgac
      481 atgtggtaca atgaggttca atacagcaac cgggattaca tcaagtccta taaacgcaac
      541 aaggaacatg ccattggcca tttcacggta atgatgtacc agaataatgt gcgcatgggc
      601 tgtgccgctg ccaaatatgg agatgagaat cccaagaaca agcaatactt cttgttggca
      661 tgcaactatg ccaataccaa ttgggttgga tggcccatct acaacagctg tagcgaacca
      721 gctacagctt gtaccaccgg taccaatcca gattatccca atttatgttc tctcgaggaa
      781 tattatgatt ttaatgcata aagcaagctg tgctatggag tttttatgtg aaag