Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250040 834 bp mRNA linear INV 02-SEP-2023 (LOC106085691), mRNA. ACCESSION XM_013250040 VERSION XM_013250040.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250040.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..834 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..834 /gene="LOC106085691" /note="antigen 5 like allergen Cul n 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 25 Proteins" /db_xref="GeneID:106085691" CDS 37..801 /gene="LOC106085691" /codon_start=1 /product="antigen 5 like allergen Cul n 1" /protein_id="XP_013105494.2" /db_xref="GeneID:106085691" /translation="MKQIFAFLGLICMLGLAKSTDYCDPKLCSEGTHIACGHSGEFAA SCPANAEIFNITEPFKDFLLKYHNEKRNYIAGGNDPNHDAACHMGTMQWDDELAALAH YNVLQCKMEHDDCHDTLDYHASGQNLAERWYTGAPNMDKLFQQSVDMWYNEVQYSNRD YIKSYKRNKEHAIGHFTVMMYQNNVRMGCAAAKYGDENPKNKQYFLLACNYANTNWVG WPIYNSCSEPATACTTGTNPDYPNLCSLEEYYDFNA" ORIGIN 1 ggactaattt ctctaacaca gctggcaaga aaagaaatga agcaaatttt tgcatttttg 61 ggtcttatct gtatgctagg tttggccaag tctacggatt attgcgatcc taagctatgc 121 tcggagggaa ctcatattgc atgtggccat agtggagaat ttgctgcttc gtgccctgcc 181 aatgctgaaa tatttaacat caccgagccc tttaaagact ttcttctgaa gtatcacaat 241 gagaaacgca attacatagc cgggggcaat gatcccaatc acgatgcagc ttgccacatg 301 ggtaccatgc aatgggacga tgaattggcc gctttggccc attacaatgt gcttcaatgc 361 aaaatggaac atgacgattg tcatgacact ttggactatc atgcgtctgg acaaaatttg 421 gccgaaagat ggtatacagg tgctccaaat atggataaat tgttccagca atccgttgac 481 atgtggtaca atgaggttca atacagcaac cgggattaca tcaagtccta taaacgcaac 541 aaggaacatg ccattggcca tttcacggta atgatgtacc agaataatgt gcgcatgggc 601 tgtgccgctg ccaaatatgg agatgagaat cccaagaaca agcaatactt cttgttggca 661 tgcaactatg ccaataccaa ttgggttgga tggcccatct acaacagctg tagcgaacca 721 gctacagctt gtaccaccgg taccaatcca gattatccca atttatgttc tctcgaggaa 781 tattatgatt ttaatgcata aagcaagctg tgctatggag tttttatgtg aaag