Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250038 828 bp mRNA linear INV 02-SEP-2023 (LOC106085689), mRNA. ACCESSION XM_013250038 VERSION XM_013250038.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250038.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..828 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..828 /gene="LOC106085689" /note="antigen 5 like allergen Cul n 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 18 Proteins" /db_xref="GeneID:106085689" CDS 40..792 /gene="LOC106085689" /codon_start=1 /product="antigen 5 like allergen Cul n 1" /protein_id="XP_013105492.2" /db_xref="GeneID:106085689" /translation="MYPIAVSMCFMAILGMAVATDYCSSSLCGGSTHIACGNNGQFAS SCPSNAALVDINPYKSYILDYHNEKRNLIAGGTVANHDAACRMATTQWDDELAKLAAL NVRQCKMAHDKCRNTDTFHYAGQNLAYRTYSGSPKYEELLKITMDMWYDEVSLSNMGY INSYPSAGVGIGHFTVMVNEKNIRVGCAAATYGTSKQTFLIACNYARTNVATLPTYTS CGTPGSSCASGKNSKYPNLCSESESYDPNNLS" ORIGIN 1 ttccatctcc accaaagaca aagagtagca cacttcaaaa tgtatcccat agcagtttca 61 atgtgcttca tggccatttt gggcatggca gtggccaccg attattgttc ctcatcactg 121 tgtggaggca gtacccacat tgcgtgtggc aataatgggc aatttgcttc ctcatgtcct 181 tcaaatgcag ctctggtcga catcaaccct tataaatcct acattcttga ttaccacaat 241 gaaaaacgta atttgatagc tggaggcacg gtggcaaatc atgatgctgc ctgtcgcatg 301 gccaccacac aatgggatga tgagttagcc aaactggccg ccttgaatgt tcgccaatgc 361 aaaatggccc atgacaaatg ccgcaacacc gataccttcc attatgctgg acagaatttg 421 gcctacagaa cttattcggg ttcgccaaaa tatgaggaat tgctgaaaat caccatggac 481 atgtggtatg acgaagtgtc gttaagtaac atgggttata ttaattccta tccctcagca 541 ggagttggca ttggccattt cactgttatg gttaatgaaa agaatatacg tgtgggctgt 601 gctgctgcca cctacggcac ctccaagcaa accttcttga tagcctgcaa ctatgccaga 661 accaatgtgg ccactttgcc cacctacacc agctgcggca ctcccggatc ctcttgtgca 721 agtggtaaaa attccaaata tcccaactta tgctcagaat ccgaatccta tgatcccaat 781 aacttgtcct aaggattatg gactttaacg ttttttttaa gtttaatt