Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1


LOCUS       XM_013250038             828 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085689), mRNA.
ACCESSION   XM_013250038
VERSION     XM_013250038.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250038.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..828
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..828
                     /gene="LOC106085689"
                     /note="antigen 5 like allergen Cul n 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 18 Proteins"
                     /db_xref="GeneID:106085689"
     CDS             40..792
                     /gene="LOC106085689"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1"
                     /protein_id="XP_013105492.2"
                     /db_xref="GeneID:106085689"
                     /translation="MYPIAVSMCFMAILGMAVATDYCSSSLCGGSTHIACGNNGQFAS
                     SCPSNAALVDINPYKSYILDYHNEKRNLIAGGTVANHDAACRMATTQWDDELAKLAAL
                     NVRQCKMAHDKCRNTDTFHYAGQNLAYRTYSGSPKYEELLKITMDMWYDEVSLSNMGY
                     INSYPSAGVGIGHFTVMVNEKNIRVGCAAATYGTSKQTFLIACNYARTNVATLPTYTS
                     CGTPGSSCASGKNSKYPNLCSESESYDPNNLS"
ORIGIN      
        1 ttccatctcc accaaagaca aagagtagca cacttcaaaa tgtatcccat agcagtttca
       61 atgtgcttca tggccatttt gggcatggca gtggccaccg attattgttc ctcatcactg
      121 tgtggaggca gtacccacat tgcgtgtggc aataatgggc aatttgcttc ctcatgtcct
      181 tcaaatgcag ctctggtcga catcaaccct tataaatcct acattcttga ttaccacaat
      241 gaaaaacgta atttgatagc tggaggcacg gtggcaaatc atgatgctgc ctgtcgcatg
      301 gccaccacac aatgggatga tgagttagcc aaactggccg ccttgaatgt tcgccaatgc
      361 aaaatggccc atgacaaatg ccgcaacacc gataccttcc attatgctgg acagaatttg
      421 gcctacagaa cttattcggg ttcgccaaaa tatgaggaat tgctgaaaat caccatggac
      481 atgtggtatg acgaagtgtc gttaagtaac atgggttata ttaattccta tccctcagca
      541 ggagttggca ttggccattt cactgttatg gttaatgaaa agaatatacg tgtgggctgt
      601 gctgctgcca cctacggcac ctccaagcaa accttcttga tagcctgcaa ctatgccaga
      661 accaatgtgg ccactttgcc cacctacacc agctgcggca ctcccggatc ctcttgtgca
      721 agtggtaaaa attccaaata tcccaactta tgctcagaat ccgaatccta tgatcccaat
      781 aacttgtcct aaggattatg gactttaacg ttttttttaa gtttaatt