Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250030 1939 bp mRNA linear INV 02-SEP-2023 cotransporter (LOC106085684), transcript variant X3, mRNA. ACCESSION XM_013250030 VERSION XM_013250030.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250030.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1939 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1939 /gene="LOC106085684" /note="hepatic sodium/bile acid cotransporter; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106085684" CDS 419..1864 /gene="LOC106085684" /codon_start=1 /product="hepatic sodium/bile acid cotransporter" /protein_id="XP_013105484.2" /db_xref="GeneID:106085684" /translation="MNSLKKLLVLCVLITQLLDLSHTQSIINGTSPLEDEVLFTLDDF VSGPAWSVSFSEKKLNMSMTDISIIQLTITDIDPAWGSDYEFHILAEDNEVVLLTQNV IKSKDIKPGDTTWHGNFTAEGLFIGHSPIYVELRRPQQQPEVALEKLQLIVLRKIGTM DYVFQILVGIFVMALYTNFGAVLELDALKQILIRPIGPLIGFLGQFVVMPVLSFFIGY LLFRDMIELRLGLFFTGSTPGGGASNIFTVVLNGNLNLSITMTAISNLAAFGMMPLWI FTLGALIFKDGNLVVPYKTIATMSFSLVIPLSIGIAMQKYYPNMAKKMSKLLKPFAFG FILIIMVFAFTVNSYMFKLFSWKILIASSALPWIGYVIGWLMAIICRQSPRDALTIAI ETGIQNTGIAIFMLNFALPQPQADMTSAVPVASSMVTPLPLLVIYVIRKIFCRSSMER VEKSSSAITKDTKLAEIEAMMEKSEKSDWHK" ORIGIN 1 aaagcgtttg cactacaatt cgtttattgg cggcaaaatc cgacgttcgg taatgataaa 61 tttccatgca tatcagcaaa tagactgcga tcgagtacaa taaaaagcgt gctgccaaaa 121 ataaagatca tatcagaaaa ttttcgttta aataccacga ttatcaagaa gttgtccaca 181 gttgcggcaa cgaaagagcc caaaaatata ctcgtcaaat aattgaaata ttaagaaaaa 241 ataactaaaa aattgatatt ggagaacata aatcaaatta agagttggat gaacgggcgg 301 atagacatcc aagcttgaaa aggataaagt cctttagtga acaaaaaaca aaaacacaac 361 tcgaataagt tcgaaattaa acaacagtgt acaaaaaata ccacagcaca actaagaaat 421 gaattccctc aaaaaacttt tagttctgtg tgtattaatt acccaattgt tagacttatc 481 ccatacacaa agtattataa atggaacctc ccccctcgag gatgaagttc tgtttacact 541 ggatgacttt gtcagtggcc cagcatggtc ggttagtttc tcagaaaaga aattaaacat 601 gtccatgacc gatattagca ttattcagct aacaatcacg gatatagacc cagcctgggg 661 atctgactat gaatttcaca ttctagccga ggataatgaa gtagtgttgc taacacaaaa 721 tgttataaaa tccaaagata ttaagcctgg agacaccaca tggcatggaa atttcaccgc 781 cgagggttta tttattggcc acagtcccat atatgtggaa ctgcgcagac ctcaacagca 841 gccagaagtg gccttggaaa agctgcaact cattgtttta cgtaaaattg gcaccatgga 901 ttatgtattt caaattctag tgggaatttt cgtcatggcc ttgtatacaa actttggagc 961 tgtgctagag ttggatgccc tcaagcagat acttattcga ccaattggac ctcttattgg 1021 atttttgggc cagtttgtgg ttatgcctgt attgagtttt ttcataggct atttgctgtt 1081 tcgcgatatg attgaattgc gtctgggtct attctttacc ggctctacac caggtggtgg 1141 tgcttcaaat atattcactg tggttcttaa tggaaatttg aatttgtcca taaccatgac 1201 ggccataagt aatttggctg cctttggcat gatgcccttg tggatattca ccttgggagc 1261 cttaatcttc aaggatggta atttggtggt gccttataag accattgcca ccatgtcctt 1321 ctcattggtc atcccgctga gtattggcat tgctatgcag aaatattatc ccaatatggc 1381 caagaaaatg tctaagctgt taaaaccctt cgcctttgga tttattctga taattatggt 1441 gtttgcattt actgttaatt cctacatgtt caaattgttc tcatggaaga ttttaattgc 1501 cagcagtgca ttgccatgga taggctatgt aatcggttgg ttgatggcca tcatttgtcg 1561 acaatcgcca cgtgacgcct taaccattgc cattgagacg ggcatacaaa ataccggtat 1621 tgcaattttc atgttaaact ttgccttgcc acaaccccag gctgatatga ccagtgctgt 1681 accggtggca agttcaatgg tcacgccatt gccattgctg gtgatctatg tgataaggaa 1741 aatcttttgt cgctccagca tggaacgagt ggagaaatca tctagcgcca ttaccaaaga 1801 taccaaactc gcagaaattg aagccatgat ggagaaaagt gaaaaatccg attggcataa 1861 atgaaaacaa cgaaattgcc tacatttata caattatgtg ataaaattgt gatgttatta 1921 tttccaagaa ataaatttt