Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans hepatic sodium/bile acid


LOCUS       XM_013250030            1939 bp    mRNA    linear   INV 02-SEP-2023
            cotransporter (LOC106085684), transcript variant X3, mRNA.
ACCESSION   XM_013250030
VERSION     XM_013250030.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250030.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1939
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1939
                     /gene="LOC106085684"
                     /note="hepatic sodium/bile acid cotransporter; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106085684"
     CDS             419..1864
                     /gene="LOC106085684"
                     /codon_start=1
                     /product="hepatic sodium/bile acid cotransporter"
                     /protein_id="XP_013105484.2"
                     /db_xref="GeneID:106085684"
                     /translation="MNSLKKLLVLCVLITQLLDLSHTQSIINGTSPLEDEVLFTLDDF
                     VSGPAWSVSFSEKKLNMSMTDISIIQLTITDIDPAWGSDYEFHILAEDNEVVLLTQNV
                     IKSKDIKPGDTTWHGNFTAEGLFIGHSPIYVELRRPQQQPEVALEKLQLIVLRKIGTM
                     DYVFQILVGIFVMALYTNFGAVLELDALKQILIRPIGPLIGFLGQFVVMPVLSFFIGY
                     LLFRDMIELRLGLFFTGSTPGGGASNIFTVVLNGNLNLSITMTAISNLAAFGMMPLWI
                     FTLGALIFKDGNLVVPYKTIATMSFSLVIPLSIGIAMQKYYPNMAKKMSKLLKPFAFG
                     FILIIMVFAFTVNSYMFKLFSWKILIASSALPWIGYVIGWLMAIICRQSPRDALTIAI
                     ETGIQNTGIAIFMLNFALPQPQADMTSAVPVASSMVTPLPLLVIYVIRKIFCRSSMER
                     VEKSSSAITKDTKLAEIEAMMEKSEKSDWHK"
ORIGIN      
        1 aaagcgtttg cactacaatt cgtttattgg cggcaaaatc cgacgttcgg taatgataaa
       61 tttccatgca tatcagcaaa tagactgcga tcgagtacaa taaaaagcgt gctgccaaaa
      121 ataaagatca tatcagaaaa ttttcgttta aataccacga ttatcaagaa gttgtccaca
      181 gttgcggcaa cgaaagagcc caaaaatata ctcgtcaaat aattgaaata ttaagaaaaa
      241 ataactaaaa aattgatatt ggagaacata aatcaaatta agagttggat gaacgggcgg
      301 atagacatcc aagcttgaaa aggataaagt cctttagtga acaaaaaaca aaaacacaac
      361 tcgaataagt tcgaaattaa acaacagtgt acaaaaaata ccacagcaca actaagaaat
      421 gaattccctc aaaaaacttt tagttctgtg tgtattaatt acccaattgt tagacttatc
      481 ccatacacaa agtattataa atggaacctc ccccctcgag gatgaagttc tgtttacact
      541 ggatgacttt gtcagtggcc cagcatggtc ggttagtttc tcagaaaaga aattaaacat
      601 gtccatgacc gatattagca ttattcagct aacaatcacg gatatagacc cagcctgggg
      661 atctgactat gaatttcaca ttctagccga ggataatgaa gtagtgttgc taacacaaaa
      721 tgttataaaa tccaaagata ttaagcctgg agacaccaca tggcatggaa atttcaccgc
      781 cgagggttta tttattggcc acagtcccat atatgtggaa ctgcgcagac ctcaacagca
      841 gccagaagtg gccttggaaa agctgcaact cattgtttta cgtaaaattg gcaccatgga
      901 ttatgtattt caaattctag tgggaatttt cgtcatggcc ttgtatacaa actttggagc
      961 tgtgctagag ttggatgccc tcaagcagat acttattcga ccaattggac ctcttattgg
     1021 atttttgggc cagtttgtgg ttatgcctgt attgagtttt ttcataggct atttgctgtt
     1081 tcgcgatatg attgaattgc gtctgggtct attctttacc ggctctacac caggtggtgg
     1141 tgcttcaaat atattcactg tggttcttaa tggaaatttg aatttgtcca taaccatgac
     1201 ggccataagt aatttggctg cctttggcat gatgcccttg tggatattca ccttgggagc
     1261 cttaatcttc aaggatggta atttggtggt gccttataag accattgcca ccatgtcctt
     1321 ctcattggtc atcccgctga gtattggcat tgctatgcag aaatattatc ccaatatggc
     1381 caagaaaatg tctaagctgt taaaaccctt cgcctttgga tttattctga taattatggt
     1441 gtttgcattt actgttaatt cctacatgtt caaattgttc tcatggaaga ttttaattgc
     1501 cagcagtgca ttgccatgga taggctatgt aatcggttgg ttgatggcca tcatttgtcg
     1561 acaatcgcca cgtgacgcct taaccattgc cattgagacg ggcatacaaa ataccggtat
     1621 tgcaattttc atgttaaact ttgccttgcc acaaccccag gctgatatga ccagtgctgt
     1681 accggtggca agttcaatgg tcacgccatt gccattgctg gtgatctatg tgataaggaa
     1741 aatcttttgt cgctccagca tggaacgagt ggagaaatca tctagcgcca ttaccaaaga
     1801 taccaaactc gcagaaattg aagccatgat ggagaaaagt gaaaaatccg attggcataa
     1861 atgaaaacaa cgaaattgcc tacatttata caattatgtg ataaaattgt gatgttatta
     1921 tttccaagaa ataaatttt