PREDICTED: Stomoxys calcitrans probable cytochrome P450 318a1

LOCUS       XM_013250022             919 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085683), mRNA.
ACCESSION   XM_013250022
VERSION     XM_013250022.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250022.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..919
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..919
                     /gene="LOC106085683"
                     /note="probable cytochrome P450 318a1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106085683"
     CDS             161..919
                     /gene="LOC106085683"
                     /codon_start=1
                     /product="probable cytochrome P450 318a1"
                     /protein_id="XP_013105476.2"
                     /db_xref="GeneID:106085683"
                     /translation="MALQSIFYGLLVLLTMVAYKQRKCWYFIWQVNGWRGVIQQPALW
                     ILLMCSVDPKSIMTSIHNFGKYFQFPLAILLFDRVLLYVDDPVTLEGVLTSPECLNKT
                     FLQNGFFANKGLLHAKGDDWKIRRKQLNPAFSHNTLISLLNDFNRVATILKDQLQSEL
                     QSNQISFIHLEELVNRAVLEVSCLTTMGVSTNFTQEDNRGIALAYRYLMELTALRILK
                     PWYQIKAVFRFLDKKKFDITQKAKALVHGFVENV"
ORIGIN      
        1 ataaaatttg tcaacaaaat attgaataat aatctcgaag acgtgttata taagtttagt
       61 gtaatagtac atacaaatta cctattaaaa attaaaatca cttatcgtag tgggctagta
      121 gtgtgccgag aaatactttt ttcatattgc aaaactagca atggctttgc aatcaatttt
      181 ttatggactt ttagtgctat taacgatggt ggcttacaaa caacgaaaat gttggtattt
      241 tatatggcaa gttaatgggt ggcgtggtgt aatccaacaa ccagcattgt ggattttatt
      301 gatgtgttct gtggacccaa agagtattat gacaagtatt cacaattttg gcaaatattt
      361 tcaatttccc ttggctatat tactattcga tcgtgtcctc ctgtatgtcg atgatcctgt
      421 taccttggaa ggtgtactga catcaccaga atgtttaaat aaaacatttt tgcagaatgg
      481 tttctttgcc aataagggtt tgctgcatgc aaagggtgat gactggaaaa tacgccgtaa
      541 acaactaaat ccagccttca gccacaatac actcatcagt cttcttaatg atttcaatcg
      601 agtggcaaca attttgaaag atcagctgca aagtgaattg cagagcaacc aaatttcatt
      661 tatacatttg gaagaattgg tgaatagagc cgtgttggag gtatcatgtt taactacaat
      721 gggcgtatca accaacttca ctcaggagga taatagaggc attgcattgg cttacagata
      781 tttaatggaa cttactgctc tgaggatttt gaagccatgg tatcaaatca aagccgtatt
      841 tcgttttttg gacaagaaaa aattcgatat tacacaaaaa gctaaagcat tggtgcatgg
      901 atttgtggaa aatgtatga