Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013250021 791 bp mRNA linear INV 02-SEP-2023 (LOC106085682), mRNA. ACCESSION XM_013250021 VERSION XM_013250021.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013250021.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..791 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..791 /gene="LOC106085682" /note="antigen 5 like allergen Cul n 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:106085682" CDS 21..791 /gene="LOC106085682" /codon_start=1 /product="antigen 5 like allergen Cul n 1-like" /protein_id="XP_013105475.2" /db_xref="GeneID:106085682" /translation="MNTLIISIGLLALMGFTLADYCSPSLCNGAQHIACGHSGRFDSS CPSNAASVNMSPSLRDYIINYHNEKRNLVAGGGAPNLQPACRMATMQWDEELAYLAAL NVRQCKMAHDKCRNTATFKYSGQNLAWRSYSGSPNYQELAKIGMDMWYDEVAHMNMDY INAYPQGYSGPAIGHFTVMMNGPNIRLGCAAATYADTGRDRQIFLIACNYARVNVATL PVYASCSSGGSECTTGRNPKYTNLCSTSEAYDVNNLFV" ORIGIN 1 attaaaagaa ttttagagca atgaatactt tgattatttc cattggcttg ttggccctta 61 tgggattcac tttggccgac tattgttcgc cttcgctgtg taacggtgcc caacatatag 121 cctgtggcca cagtgggaga tttgattcct catgtccttc caatgccgcc tcagtgaaca 181 tgagtccctc tttgcgggat tacattataa actatcacaa tgagaaacgt aatctggtag 241 caggtggtgg tgctcccaat cttcagcctg cttgtcgaat ggctacaatg caatgggacg 301 aagaattggc ctatctggct gccctcaatg tgcgccaatg caagatggcc catgacaaat 361 gtcgcaatac tgccactttt aaatactcgg gtcaaaattt ggcctggaga tcgtattctg 421 gtagccccaa ttatcaggaa ttggcaaaaa taggcatgga catgtggtat gatgaagtgg 481 cacacatgaa catggactac atcaatgcct acccccaggg ctactcagga ccagccattg 541 gccatttcac tgtaatgatg aatgggccca acatacgcct gggttgtgct gcagccactt 601 atgccgatac tggtcgcgat agacaaattt tcttgatagc ctgcaactat gccagagtca 661 atgtggcaac tctgcccgtt tatgccagct gcagttcggg aggtagcgaa tgcaccactg 721 gacgtaatcc taagtatacc aatttgtgtt ccacctcgga agcttatgat gtcaataatt 781 tgtttgtata g