Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans antigen 5 like allergen Cul n 1-like


LOCUS       XM_013250021             791 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085682), mRNA.
ACCESSION   XM_013250021
VERSION     XM_013250021.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013250021.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..791
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..791
                     /gene="LOC106085682"
                     /note="antigen 5 like allergen Cul n 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 15 Proteins"
                     /db_xref="GeneID:106085682"
     CDS             21..791
                     /gene="LOC106085682"
                     /codon_start=1
                     /product="antigen 5 like allergen Cul n 1-like"
                     /protein_id="XP_013105475.2"
                     /db_xref="GeneID:106085682"
                     /translation="MNTLIISIGLLALMGFTLADYCSPSLCNGAQHIACGHSGRFDSS
                     CPSNAASVNMSPSLRDYIINYHNEKRNLVAGGGAPNLQPACRMATMQWDEELAYLAAL
                     NVRQCKMAHDKCRNTATFKYSGQNLAWRSYSGSPNYQELAKIGMDMWYDEVAHMNMDY
                     INAYPQGYSGPAIGHFTVMMNGPNIRLGCAAATYADTGRDRQIFLIACNYARVNVATL
                     PVYASCSSGGSECTTGRNPKYTNLCSTSEAYDVNNLFV"
ORIGIN      
        1 attaaaagaa ttttagagca atgaatactt tgattatttc cattggcttg ttggccctta
       61 tgggattcac tttggccgac tattgttcgc cttcgctgtg taacggtgcc caacatatag
      121 cctgtggcca cagtgggaga tttgattcct catgtccttc caatgccgcc tcagtgaaca
      181 tgagtccctc tttgcgggat tacattataa actatcacaa tgagaaacgt aatctggtag
      241 caggtggtgg tgctcccaat cttcagcctg cttgtcgaat ggctacaatg caatgggacg
      301 aagaattggc ctatctggct gccctcaatg tgcgccaatg caagatggcc catgacaaat
      361 gtcgcaatac tgccactttt aaatactcgg gtcaaaattt ggcctggaga tcgtattctg
      421 gtagccccaa ttatcaggaa ttggcaaaaa taggcatgga catgtggtat gatgaagtgg
      481 cacacatgaa catggactac atcaatgcct acccccaggg ctactcagga ccagccattg
      541 gccatttcac tgtaatgatg aatgggccca acatacgcct gggttgtgct gcagccactt
      601 atgccgatac tggtcgcgat agacaaattt tcttgatagc ctgcaactat gccagagtca
      661 atgtggcaac tctgcccgtt tatgccagct gcagttcggg aggtagcgaa tgcaccactg
      721 gacgtaatcc taagtatacc aatttgtgtt ccacctcgga agcttatgat gtcaataatt
      781 tgtttgtata g