Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249989 1275 bp mRNA linear INV 02-SEP-2023 (LOC106085659), mRNA. ACCESSION XM_013249989 VERSION XM_013249989.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249989.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1275 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1275 /gene="LOC106085659" /note="vesicle-trafficking protein SEC22b-B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106085659" CDS 142..777 /gene="LOC106085659" /codon_start=1 /product="vesicle-trafficking protein SEC22b-B" /protein_id="XP_013105443.1" /db_xref="GeneID:106085659" /translation="MALLTMIARVIDGLPLVGTMQDDEQTGRSIMEYQNQAKMLFRKL GSHSPARCSIETGPYLFHYLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHTNYGRK VNSVTRPYAFIEFDVYIQKAKKQLTDRRRNINTINTQLQDVQRIMVQNIDDVLQRGTV LSELDTKTQNLSMMSQKYKKDATYLNRKSMYVKAAAAGIVVIVFILYFWVL" misc_feature 148..516 /gene="LOC106085659" /note="longin domain; Region: Longin; cd14824" /db_xref="CDD:341428" misc_feature order(148..150,238..240,247..249,307..309,316..318, 322..324) /gene="LOC106085659" /note="lipid binding site [chemical binding]; lipid-binding site" /db_xref="CDD:341428" misc_feature order(184..186,193..195,199..201,241..243,253..255, 490..492,502..504,511..513) /gene="LOC106085659" /note="Sec22 interface [polypeptide binding]; other site" /db_xref="CDD:341428" misc_feature order(304..306,313..315,373..375,385..387) /gene="LOC106085659" /note="VARP interface [polypeptide binding]; other site" /db_xref="CDD:341428" misc_feature 529..720 /gene="LOC106085659" /note="SNARE motif of SEC22; Region: R-SNARE_SEC22; cd15866" /db_xref="CDD:277219" misc_feature order(535..543,547..552,556..573,577..585,589..591, 598..603,607..615,619..636,640..657,661..678,682..699, 703..711) /gene="LOC106085659" /note="heterotetramer interface [polypeptide binding]; other site" /db_xref="CDD:277219" misc_feature 610..612 /gene="LOC106085659" /note="zero layer; other site" /db_xref="CDD:277219" polyA_site 1275 /gene="LOC106085659" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccatcagact aaaattatcg ataaacggct gacgtgttgg ggtccgggaa aggaattaat 61 tccctgtttt tgtttgccag ataaatttca taattcaacg aagggatacg tttatacatt 121 ttaaaataac aatacaaagc aatggctttg ttgactatga tagcacgagt catcgatggg 181 cttccgctgg tgggcaccat gcaagatgat gaacagactg gacgcagcat tatggaatat 241 cagaatcaag caaaaatgtt attccgcaaa ttgggttcac attcaccagc cagatgtagt 301 atcgaaaccg gtccctatct tttccattat ttaatagaga atgatgtttg ttatctggtg 361 atggtagaca aaatgtactc taaacgtttg gccttcaatt atttagaaga cttagcccag 421 gagttccata caaactatgg ccgcaaagtg aattcagtga caagacctta tgcttttata 481 gaattcgatg tttatataca aaaagctaag aagcaattga ccgatcgaag acgcaatata 541 aacacaatca atacacagct acaagatgtg cagaggatta tggttcaaaa tattgacgat 601 gtcctgcaac gtggcactgt tctatcagaa cttgatacca aaacccaaaa tctgtccatg 661 atgtcacaga aatataaaaa agatgccacc tatttaaatc gtaaatcgat gtatgtaaaa 721 gccgcagctg cgggtattgt tgttatagta tttattttat acttttgggt tttgtaatag 781 tggtatgttc aaacagaggc agagaataca gacaccaacc aattaaaaaa gtttatgttt 841 tatgtattta ggctaaaatg aaagcaaaca cttataattt attcacacaa aatagaaaaa 901 tatgtttttt tgcataccat catacctaat tccatacaca cactctccct ctctctatat 961 ataaatgaat gttgtattgt ttttggtttt ttttttaaga aaggaaaatt tttttgagtc 1021 ggtttaacta taactttttt ctttttttat aagtgatgat gaaaattaag acaatttaat 1081 tacatttatt aatttaggtg aagtacgaaa aaaatagaaa aaaactatta aacgaattgt 1141 tccatataac ataaattgtt tatttttatt taataaaaaa tgaatcacat ttcactcaat 1201 cactgatctt ggtcttcttc atcttctgtg gtggaagata agacctccat taattgctca 1261 tcagtaaaaa ggaaa