Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans vesicle-trafficking protein SEC22b-B


LOCUS       XM_013249989            1275 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085659), mRNA.
ACCESSION   XM_013249989
VERSION     XM_013249989.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249989.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1275
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1275
                     /gene="LOC106085659"
                     /note="vesicle-trafficking protein SEC22b-B; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 9 Proteins"
                     /db_xref="GeneID:106085659"
     CDS             142..777
                     /gene="LOC106085659"
                     /codon_start=1
                     /product="vesicle-trafficking protein SEC22b-B"
                     /protein_id="XP_013105443.1"
                     /db_xref="GeneID:106085659"
                     /translation="MALLTMIARVIDGLPLVGTMQDDEQTGRSIMEYQNQAKMLFRKL
                     GSHSPARCSIETGPYLFHYLIENDVCYLVMVDKMYSKRLAFNYLEDLAQEFHTNYGRK
                     VNSVTRPYAFIEFDVYIQKAKKQLTDRRRNINTINTQLQDVQRIMVQNIDDVLQRGTV
                     LSELDTKTQNLSMMSQKYKKDATYLNRKSMYVKAAAAGIVVIVFILYFWVL"
     misc_feature    148..516
                     /gene="LOC106085659"
                     /note="longin domain; Region: Longin; cd14824"
                     /db_xref="CDD:341428"
     misc_feature    order(148..150,238..240,247..249,307..309,316..318,
                     322..324)
                     /gene="LOC106085659"
                     /note="lipid binding site [chemical binding];
                     lipid-binding site"
                     /db_xref="CDD:341428"
     misc_feature    order(184..186,193..195,199..201,241..243,253..255,
                     490..492,502..504,511..513)
                     /gene="LOC106085659"
                     /note="Sec22 interface [polypeptide binding]; other site"
                     /db_xref="CDD:341428"
     misc_feature    order(304..306,313..315,373..375,385..387)
                     /gene="LOC106085659"
                     /note="VARP interface [polypeptide binding]; other site"
                     /db_xref="CDD:341428"
     misc_feature    529..720
                     /gene="LOC106085659"
                     /note="SNARE motif of SEC22; Region: R-SNARE_SEC22;
                     cd15866"
                     /db_xref="CDD:277219"
     misc_feature    order(535..543,547..552,556..573,577..585,589..591,
                     598..603,607..615,619..636,640..657,661..678,682..699,
                     703..711)
                     /gene="LOC106085659"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277219"
     misc_feature    610..612
                     /gene="LOC106085659"
                     /note="zero layer; other site"
                     /db_xref="CDD:277219"
     polyA_site      1275
                     /gene="LOC106085659"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccatcagact aaaattatcg ataaacggct gacgtgttgg ggtccgggaa aggaattaat
       61 tccctgtttt tgtttgccag ataaatttca taattcaacg aagggatacg tttatacatt
      121 ttaaaataac aatacaaagc aatggctttg ttgactatga tagcacgagt catcgatggg
      181 cttccgctgg tgggcaccat gcaagatgat gaacagactg gacgcagcat tatggaatat
      241 cagaatcaag caaaaatgtt attccgcaaa ttgggttcac attcaccagc cagatgtagt
      301 atcgaaaccg gtccctatct tttccattat ttaatagaga atgatgtttg ttatctggtg
      361 atggtagaca aaatgtactc taaacgtttg gccttcaatt atttagaaga cttagcccag
      421 gagttccata caaactatgg ccgcaaagtg aattcagtga caagacctta tgcttttata
      481 gaattcgatg tttatataca aaaagctaag aagcaattga ccgatcgaag acgcaatata
      541 aacacaatca atacacagct acaagatgtg cagaggatta tggttcaaaa tattgacgat
      601 gtcctgcaac gtggcactgt tctatcagaa cttgatacca aaacccaaaa tctgtccatg
      661 atgtcacaga aatataaaaa agatgccacc tatttaaatc gtaaatcgat gtatgtaaaa
      721 gccgcagctg cgggtattgt tgttatagta tttattttat acttttgggt tttgtaatag
      781 tggtatgttc aaacagaggc agagaataca gacaccaacc aattaaaaaa gtttatgttt
      841 tatgtattta ggctaaaatg aaagcaaaca cttataattt attcacacaa aatagaaaaa
      901 tatgtttttt tgcataccat catacctaat tccatacaca cactctccct ctctctatat
      961 ataaatgaat gttgtattgt ttttggtttt ttttttaaga aaggaaaatt tttttgagtc
     1021 ggtttaacta taactttttt ctttttttat aagtgatgat gaaaattaag acaatttaat
     1081 tacatttatt aatttaggtg aagtacgaaa aaaatagaaa aaaactatta aacgaattgt
     1141 tccatataac ataaattgtt tatttttatt taataaaaaa tgaatcacat ttcactcaat
     1201 cactgatctt ggtcttcttc atcttctgtg gtggaagata agacctccat taattgctca
     1261 tcagtaaaaa ggaaa