PREDICTED: Stomoxys calcitrans protein kish (LOC106085662), mRNA.

LOCUS       XM_013249988             472 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013249988
VERSION     XM_013249988.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249988.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..472
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..472
                     /gene="LOC106085662"
                     /note="protein kish; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 17 Proteins"
                     /db_xref="GeneID:106085662"
     CDS             107..325
                     /gene="LOC106085662"
                     /codon_start=1
                     /product="protein kish"
                     /protein_id="XP_013105442.1"
                     /db_xref="GeneID:106085662"
                     /translation="MSALFNFQSLLSVILLMICTCAYLRSLFPSIIDRNKTGLLGIFW
                     KLARIGERKSPYVAFACVIMAASLLFWT"
     misc_feature    134..238
                     /gene="LOC106085662"
                     /note="Protein of unknown function (DUF1242); Region:
                     DUF1242; pfam06842"
                     /db_xref="CDD:462019"
     polyA_site      472
                     /gene="LOC106085662"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taaatcgtac tgacaacaaa acaaatgaaa acttggtggg cacgtcattc ttgttaaaaa
       61 gtccaatatt tctttttaaa taaaagggag aaataaatta aaaataatga gtgctttatt
      121 taattttcaa agtctattgt ctgtcatttt attgatgatt tgcacctgtg catatcttcg
      181 atcacttttt cccagcatca ttgaccgaaa caagactgga ttattgggca tcttctggaa
      241 gttggcgaga ataggcgaaa ggaaatctcc ctacgtggct tttgcttgcg ttattatggc
      301 agcctctttg ctattttgga cgtgatgaat aagggcatgg aatttgtata cagagattaa
      361 ggataagagt gtttcttgtg atgttctgtt ccaaacatta taatgaattt tcttttgttt
      421 gtagatttgc taccaattaa ccgtgtatat aaatacaata atttttaaga ta