PREDICTED: Stomoxys calcitrans uncharacterized LOC106085657

LOCUS       XM_013249984             393 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085657), mRNA.
ACCESSION   XM_013249984
VERSION     XM_013249984.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249984.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..393
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..393
                     /gene="LOC106085657"
                     /note="uncharacterized LOC106085657; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106085657"
     CDS             1..393
                     /gene="LOC106085657"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085657"
                     /protein_id="XP_013105438.2"
                     /db_xref="GeneID:106085657"
                     /translation="MVALNIKVGLYKTPVTNSTANIALYKRANGYRPFLYNKTHDICA
                     FFANRKRFPFFYVMMGIFLERSNLNHTCPYNDAIMVKNLVLNEDMFHLIPIPEGDYRI
                     NANIYAYNDLKASLQVFISRKDVFSKHI"
ORIGIN      
        1 atggtggcac ttaatatcaa agtgggcctc tataagacgc ctgtcactaa ttcaacggca
       61 aatattgctt tgtacaaacg cgccaatgga tatcgaccat ttttgtacaa taaaacccat
      121 gatatttgtg ctttctttgc caatcgcaag cgttttccct ttttctatgt gatgatgggt
      181 atatttctgg aaagatccaa tttgaaccac acatgccctt ataatgatgc gatcatggtc
      241 aagaatcttg tcttgaacga agatatgttt cacctgattc ccattcccga gggtgattac
      301 aggataaacg caaacattta tgcctacaat gatttaaagg ccagtcttca agtttttata
      361 tcaagaaagg atgtttttag caagcacata tga