Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085544


LOCUS       XM_013249848             759 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085544), transcript variant X2, mRNA.
ACCESSION   XM_013249848
VERSION     XM_013249848.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249848.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..759
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..759
                     /gene="LOC106085544"
                     /note="uncharacterized LOC106085544; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106085544"
     CDS             69..656
                     /gene="LOC106085544"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085544 isoform X2"
                     /protein_id="XP_013105302.1"
                     /db_xref="GeneID:106085544"
                     /translation="MKAFVCLVLIGVASVTAKPKPGGGWSSGGGGGGGWSSGGGGGGG
                     GGGGGGDVQIVKIITEGGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGGGGGGGGGS
                     DIKLVKIISLGGGGGGGGGGGWSSGGGGGGGGGWSSGGGGGGGGGGGGSTKIIKIIKL
                     GGGGGGGGGHGGGGGGWSSGGGGGGGGWQPSGGWA"
ORIGIN      
        1 gttggataag caaatccata accgttaaaa gtcgcgaaat cgaccataca aaggattaaa
       61 gccacaccat gaaagcgttt gtttgtttag ttttgattgg cgttgcctca gtgactgcca
      121 aaccaaagcc tggaggaggc tggtctagtg gtggcggcgg aggaggtgga tggtcatccg
      181 gtggaggagg tggtggagga ggaggcggtg gaggcggtga tgtgcaaata gttaaaatca
      241 taacagaagg aggcggcgga ggaggtggtg gtggttggtc tagtggtggt ggtggaggag
      301 gcggcgggtg gtctagcggc ggaggaggtg gcggttggtc atctggtggc ggaggaggag
      361 gtggtggagg aagcgatatt aaacttgtta aaatcattag cctgggtgga ggtggaggcg
      421 gaggtggtgg cggtggatgg tcatctggtg gtggtggtgg tggtggtggc ggttggtctt
      481 caggcggcgg tggtggtggt ggtggtggcg gaggtggctc aactaaaatt attaaaatca
      541 taaagttagg tggtggtgga ggaggcggcg gtggtcatgg tggcggcggt ggcggttggt
      601 catctggcgg tggaggcggc ggtggtggct ggcagccctc tggcggttgg gcctaactcg
      661 tgttaccaaa atttgtacat attgtaaata attcaatgtc ttttttacaa gtacttttta
      721 ttattttttt gttttataaa taaaaagaaa aaaatttaa