Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249848 759 bp mRNA linear INV 02-SEP-2023 (LOC106085544), transcript variant X2, mRNA. ACCESSION XM_013249848 VERSION XM_013249848.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249848.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..759 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..759 /gene="LOC106085544" /note="uncharacterized LOC106085544; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106085544" CDS 69..656 /gene="LOC106085544" /codon_start=1 /product="uncharacterized protein LOC106085544 isoform X2" /protein_id="XP_013105302.1" /db_xref="GeneID:106085544" /translation="MKAFVCLVLIGVASVTAKPKPGGGWSSGGGGGGGWSSGGGGGGG GGGGGGDVQIVKIITEGGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGGGGGGGGGS DIKLVKIISLGGGGGGGGGGGWSSGGGGGGGGGWSSGGGGGGGGGGGGSTKIIKIIKL GGGGGGGGGHGGGGGGWSSGGGGGGGGWQPSGGWA" ORIGIN 1 gttggataag caaatccata accgttaaaa gtcgcgaaat cgaccataca aaggattaaa 61 gccacaccat gaaagcgttt gtttgtttag ttttgattgg cgttgcctca gtgactgcca 121 aaccaaagcc tggaggaggc tggtctagtg gtggcggcgg aggaggtgga tggtcatccg 181 gtggaggagg tggtggagga ggaggcggtg gaggcggtga tgtgcaaata gttaaaatca 241 taacagaagg aggcggcgga ggaggtggtg gtggttggtc tagtggtggt ggtggaggag 301 gcggcgggtg gtctagcggc ggaggaggtg gcggttggtc atctggtggc ggaggaggag 361 gtggtggagg aagcgatatt aaacttgtta aaatcattag cctgggtgga ggtggaggcg 421 gaggtggtgg cggtggatgg tcatctggtg gtggtggtgg tggtggtggc ggttggtctt 481 caggcggcgg tggtggtggt ggtggtggcg gaggtggctc aactaaaatt attaaaatca 541 taaagttagg tggtggtgga ggaggcggcg gtggtcatgg tggcggcggt ggcggttggt 601 catctggcgg tggaggcggc ggtggtggct ggcagccctc tggcggttgg gcctaactcg 661 tgttaccaaa atttgtacat attgtaaata attcaatgtc ttttttacaa gtacttttta 721 ttattttttt gttttataaa taaaaagaaa aaaatttaa