Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249847 924 bp mRNA linear INV 02-SEP-2023 (LOC106085544), transcript variant X1, mRNA. ACCESSION XM_013249847 VERSION XM_013249847.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249847.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..924 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..924 /gene="LOC106085544" /note="uncharacterized LOC106085544; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106085544" CDS 210..821 /gene="LOC106085544" /codon_start=1 /product="uncharacterized protein LOC106085544 isoform X1" /protein_id="XP_013105301.1" /db_xref="GeneID:106085544" /translation="MFDNILRDPKAFVCLVLIGVASVTAKPKPGGGWSSGGGGGGGWS SGGGGGGGGGGGGGDVQIVKIITEGGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGG GGGGGGGSDIKLVKIISLGGGGGGGGGGGWSSGGGGGGGGGWSSGGGGGGGGGGGGST KIIKIIKLGGGGGGGGGHGGGGGGWSSGGGGGGGGWQPSGGWA" ORIGIN 1 ctcccatagc agaaaattag tcgtaaaagt gtcacttttt gatctaacag tcacttcgtt 61 tatggcaaaa cctttaggat tttggtctgc gcaacaggtg ctttgttaaa cgaaaagatg 121 atttctttgc gtagagtgat tgtgccgatt gtgcatccgt gcaatcttgg gaagtaacaa 181 tttttcaaaa ttcacttgag gtggacaaaa tgtttgataa tattttgcgc gatcccaaag 241 cgtttgtttg tttagttttg attggcgttg cctcagtgac tgccaaacca aagcctggag 301 gaggctggtc tagtggtggc ggcggaggag gtggatggtc atccggtgga ggaggtggtg 361 gaggaggagg cggtggaggc ggtgatgtgc aaatagttaa aatcataaca gaaggaggcg 421 gcggaggagg tggtggtggt tggtctagtg gtggtggtgg aggaggcggc gggtggtcta 481 gcggcggagg aggtggcggt tggtcatctg gtggcggagg aggaggtggt ggaggaagcg 541 atattaaact tgttaaaatc attagcctgg gtggaggtgg aggcggaggt ggtggcggtg 601 gatggtcatc tggtggtggt ggtggtggtg gtggcggttg gtcttcaggc ggcggtggtg 661 gtggtggtgg tggcggaggt ggctcaacta aaattattaa aatcataaag ttaggtggtg 721 gtggaggagg cggcggtggt catggtggcg gcggtggcgg ttggtcatct ggcggtggag 781 gcggcggtgg tggctggcag ccctctggcg gttgggccta actcgtgtta ccaaaatttg 841 tacatattgt aaataattca atgtcttttt tacaagtact ttttattatt tttttgtttt 901 ataaataaaa agaaaaaaat ttaa