Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085544


LOCUS       XM_013249847             924 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085544), transcript variant X1, mRNA.
ACCESSION   XM_013249847
VERSION     XM_013249847.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249847.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..924
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..924
                     /gene="LOC106085544"
                     /note="uncharacterized LOC106085544; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106085544"
     CDS             210..821
                     /gene="LOC106085544"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085544 isoform X1"
                     /protein_id="XP_013105301.1"
                     /db_xref="GeneID:106085544"
                     /translation="MFDNILRDPKAFVCLVLIGVASVTAKPKPGGGWSSGGGGGGGWS
                     SGGGGGGGGGGGGGDVQIVKIITEGGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGG
                     GGGGGGGSDIKLVKIISLGGGGGGGGGGGWSSGGGGGGGGGWSSGGGGGGGGGGGGST
                     KIIKIIKLGGGGGGGGGHGGGGGGWSSGGGGGGGGWQPSGGWA"
ORIGIN      
        1 ctcccatagc agaaaattag tcgtaaaagt gtcacttttt gatctaacag tcacttcgtt
       61 tatggcaaaa cctttaggat tttggtctgc gcaacaggtg ctttgttaaa cgaaaagatg
      121 atttctttgc gtagagtgat tgtgccgatt gtgcatccgt gcaatcttgg gaagtaacaa
      181 tttttcaaaa ttcacttgag gtggacaaaa tgtttgataa tattttgcgc gatcccaaag
      241 cgtttgtttg tttagttttg attggcgttg cctcagtgac tgccaaacca aagcctggag
      301 gaggctggtc tagtggtggc ggcggaggag gtggatggtc atccggtgga ggaggtggtg
      361 gaggaggagg cggtggaggc ggtgatgtgc aaatagttaa aatcataaca gaaggaggcg
      421 gcggaggagg tggtggtggt tggtctagtg gtggtggtgg aggaggcggc gggtggtcta
      481 gcggcggagg aggtggcggt tggtcatctg gtggcggagg aggaggtggt ggaggaagcg
      541 atattaaact tgttaaaatc attagcctgg gtggaggtgg aggcggaggt ggtggcggtg
      601 gatggtcatc tggtggtggt ggtggtggtg gtggcggttg gtcttcaggc ggcggtggtg
      661 gtggtggtgg tggcggaggt ggctcaacta aaattattaa aatcataaag ttaggtggtg
      721 gtggaggagg cggcggtggt catggtggcg gcggtggcgg ttggtcatct ggcggtggag
      781 gcggcggtgg tggctggcag ccctctggcg gttgggccta actcgtgtta ccaaaatttg
      841 tacatattgt aaataattca atgtcttttt tacaagtact ttttattatt tttttgtttt
      901 ataaataaaa agaaaaaaat ttaa