Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cytochrome c oxidase assembly factor


LOCUS       XM_013249838             507 bp    mRNA    linear   INV 02-SEP-2023
            6 homolog (LOC106085534), mRNA.
ACCESSION   XM_013249838
VERSION     XM_013249838.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249838.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..507
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..507
                     /gene="LOC106085534"
                     /note="cytochrome c oxidase assembly factor 6 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:106085534"
     CDS             110..370
                     /gene="LOC106085534"
                     /codon_start=1
                     /product="cytochrome c oxidase assembly factor 6 homolog"
                     /protein_id="XP_013105292.1"
                     /db_xref="GeneID:106085534"
                     /translation="MSFPTKEERTQCWNSRDEYWKCLSENAPNHSSTSGEKIPDACKK
                     LRKLFETSCPKTWVKHFDRKRTYEQFKQKMDQGIDPLNEPKK"
     misc_feature    116..316
                     /gene="LOC106085534"
                     /note="Cytochrome oxidase c subunit VIb; Region: COX6B;
                     pfam02297"
                     /db_xref="CDD:426708"
     misc_feature    125..127
                     /gene="LOC106085534"
                     /note="Subunit VIb/I interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(137..139,146..148,320..322)
                     /gene="LOC106085534"
                     /note="Subunit VIb/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(185..187,215..229,233..235)
                     /gene="LOC106085534"
                     /note="Subunit VIb/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(299..301,308..316)
                     /gene="LOC106085534"
                     /note="Subunit VIb/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     polyA_site      507
                     /gene="LOC106085534"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcatatgttt acccaaattt taaagttcta tttctttatg caacttcttt aggtttttga
       61 gaaaagttaa attccagcta atttataaaa gaaatttcaa ttaatcacca tgagctttcc
      121 caccaaagag gagcgaacac aatgctggaa tagtcgtgat gaatattgga aatgtcttag
      181 tgaaaatgcc ccaaatcaca gttcaacttc aggtgaaaag attccggacg cctgcaaaaa
      241 gctgagaaaa ctattcgaaa ccagctgtcc caaaacgtgg gtgaaacact tcgatcgcaa
      301 aaggacgtat gagcaattta aacaaaaaat ggatcagggc attgatccac tgaatgaacc
      361 aaagaagtaa caagggagga agaaaagtca attgtacaaa atataaagct tctttctaca
      421 tagtgttcat agattttgtt aatgtactct taattaaaaa aaatatgtat gtattttgtt
      481 attttaaaat aaactaaaaa ctactaa