Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249838 507 bp mRNA linear INV 02-SEP-2023 6 homolog (LOC106085534), mRNA. ACCESSION XM_013249838 VERSION XM_013249838.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249838.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..507 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..507 /gene="LOC106085534" /note="cytochrome c oxidase assembly factor 6 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106085534" CDS 110..370 /gene="LOC106085534" /codon_start=1 /product="cytochrome c oxidase assembly factor 6 homolog" /protein_id="XP_013105292.1" /db_xref="GeneID:106085534" /translation="MSFPTKEERTQCWNSRDEYWKCLSENAPNHSSTSGEKIPDACKK LRKLFETSCPKTWVKHFDRKRTYEQFKQKMDQGIDPLNEPKK" misc_feature 116..316 /gene="LOC106085534" /note="Cytochrome oxidase c subunit VIb; Region: COX6B; pfam02297" /db_xref="CDD:426708" misc_feature 125..127 /gene="LOC106085534" /note="Subunit VIb/I interface [polypeptide binding]; other site" /db_xref="CDD:238466" misc_feature order(137..139,146..148,320..322) /gene="LOC106085534" /note="Subunit VIb/III interface [polypeptide binding]; other site" /db_xref="CDD:238466" misc_feature order(185..187,215..229,233..235) /gene="LOC106085534" /note="Subunit VIb/VIb interface [polypeptide binding]; other site" /db_xref="CDD:238466" misc_feature order(299..301,308..316) /gene="LOC106085534" /note="Subunit VIb/VIa interface [polypeptide binding]; other site" /db_xref="CDD:238466" polyA_site 507 /gene="LOC106085534" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcatatgttt acccaaattt taaagttcta tttctttatg caacttcttt aggtttttga 61 gaaaagttaa attccagcta atttataaaa gaaatttcaa ttaatcacca tgagctttcc 121 caccaaagag gagcgaacac aatgctggaa tagtcgtgat gaatattgga aatgtcttag 181 tgaaaatgcc ccaaatcaca gttcaacttc aggtgaaaag attccggacg cctgcaaaaa 241 gctgagaaaa ctattcgaaa ccagctgtcc caaaacgtgg gtgaaacact tcgatcgcaa 301 aaggacgtat gagcaattta aacaaaaaat ggatcagggc attgatccac tgaatgaacc 361 aaagaagtaa caagggagga agaaaagtca attgtacaaa atataaagct tctttctaca 421 tagtgttcat agattttgtt aatgtactct taattaaaaa aaatatgtat gtattttgtt 481 attttaaaat aaactaaaaa ctactaa