Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249836 709 bp mRNA linear INV 02-SEP-2023 (LOC106085535), mRNA. ACCESSION XM_013249836 VERSION XM_013249836.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249836.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..709 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..709 /gene="LOC106085535" /note="ferritin-2 heavy chain; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106085535" CDS 80..652 /gene="LOC106085535" /codon_start=1 /product="ferritin-2 heavy chain" /protein_id="XP_013105290.1" /db_xref="GeneID:106085535" /translation="MYRFRNFCNCRRLFSVLVQDNFAKECEEILNKQINLELKAFYSY LAMAFHFDRSDAASPGAFKFFKNASEEERQHAILIMEYMNKRGGDLKLNAIQSPKLSF QSIKEAMLEALSMEKDVNTALLEAHAIADRNNDPNMCDFIETNFLQEQVDGIKQLADY VTQIEKSECDLSSYLFDKYLMQDSGGMHKK" misc_feature 149..616 /gene="LOC106085535" /note="eukaryotic ferritins; Region: Euk_Ferritin; cd01056" /db_xref="CDD:153114" misc_feature order(188..190,209..211,290..295,302..304,425..427, 527..529) /gene="LOC106085535" /note="ferroxidase diiron center [ion binding]; other site" /db_xref="CDD:153114" misc_feature order(278..280,287..292,299..301) /gene="LOC106085535" /note="ferrihydrite nucleation center [active]" /db_xref="CDD:153114" misc_feature order(458..460,497..499,506..508) /gene="LOC106085535" /note="iron ion channel [active]" /db_xref="CDD:153114" polyA_site 709 /gene="LOC106085535" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcccgtgaat tatttgtgaa ttcattgcat tgtgtattaa tttgtcaata gaaattccaa 61 accttttttt tttttaaata tgtatcgttt tcgtaacttc tgtaattgcc gtcgtctatt 121 ttcagttttg gtgcaagata atttcgctaa agaatgtgaa gaaattttga acaaacaaat 181 caatttagag cttaaggcgt tttatagcta tttggccatg gcatttcatt tcgatcgtag 241 tgatgcagct tcgccaggag cctttaaatt tttcaaaaat gccagtgagg aggagcgtca 301 acatgccatt ctaattatgg agtatatgaa caaaagagga ggtgatttaa aattaaatgc 361 aatccaaagt cccaaattgt cattccaatc gataaaggaa gctatgcttg aggcacttag 421 tatggagaag gatgttaata cggctctttt ggaagctcat gcaattgctg acagaaacaa 481 tgatcccaat atgtgtgatt ttattgagac gaattttttg caagaacaag tggatggtat 541 caagcaattg gccgactatg taactcaaat tgagaagtcc gaatgtgatc tgagcagcta 601 tttgtttgac aagtatttaa tgcaagactc gggtggcatg cacaaaaaat aaaatttatt 661 gcatataaaa gaatgatgac gaaaatatag aaaatgtgca taacattta