Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ferritin-2 heavy chain


LOCUS       XM_013249836             709 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085535), mRNA.
ACCESSION   XM_013249836
VERSION     XM_013249836.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249836.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..709
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..709
                     /gene="LOC106085535"
                     /note="ferritin-2 heavy chain; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106085535"
     CDS             80..652
                     /gene="LOC106085535"
                     /codon_start=1
                     /product="ferritin-2 heavy chain"
                     /protein_id="XP_013105290.1"
                     /db_xref="GeneID:106085535"
                     /translation="MYRFRNFCNCRRLFSVLVQDNFAKECEEILNKQINLELKAFYSY
                     LAMAFHFDRSDAASPGAFKFFKNASEEERQHAILIMEYMNKRGGDLKLNAIQSPKLSF
                     QSIKEAMLEALSMEKDVNTALLEAHAIADRNNDPNMCDFIETNFLQEQVDGIKQLADY
                     VTQIEKSECDLSSYLFDKYLMQDSGGMHKK"
     misc_feature    149..616
                     /gene="LOC106085535"
                     /note="eukaryotic ferritins; Region: Euk_Ferritin;
                     cd01056"
                     /db_xref="CDD:153114"
     misc_feature    order(188..190,209..211,290..295,302..304,425..427,
                     527..529)
                     /gene="LOC106085535"
                     /note="ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153114"
     misc_feature    order(278..280,287..292,299..301)
                     /gene="LOC106085535"
                     /note="ferrihydrite nucleation center [active]"
                     /db_xref="CDD:153114"
     misc_feature    order(458..460,497..499,506..508)
                     /gene="LOC106085535"
                     /note="iron ion channel [active]"
                     /db_xref="CDD:153114"
     polyA_site      709
                     /gene="LOC106085535"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcccgtgaat tatttgtgaa ttcattgcat tgtgtattaa tttgtcaata gaaattccaa
       61 accttttttt tttttaaata tgtatcgttt tcgtaacttc tgtaattgcc gtcgtctatt
      121 ttcagttttg gtgcaagata atttcgctaa agaatgtgaa gaaattttga acaaacaaat
      181 caatttagag cttaaggcgt tttatagcta tttggccatg gcatttcatt tcgatcgtag
      241 tgatgcagct tcgccaggag cctttaaatt tttcaaaaat gccagtgagg aggagcgtca
      301 acatgccatt ctaattatgg agtatatgaa caaaagagga ggtgatttaa aattaaatgc
      361 aatccaaagt cccaaattgt cattccaatc gataaaggaa gctatgcttg aggcacttag
      421 tatggagaag gatgttaata cggctctttt ggaagctcat gcaattgctg acagaaacaa
      481 tgatcccaat atgtgtgatt ttattgagac gaattttttg caagaacaag tggatggtat
      541 caagcaattg gccgactatg taactcaaat tgagaagtcc gaatgtgatc tgagcagcta
      601 tttgtttgac aagtatttaa tgcaagactc gggtggcatg cacaaaaaat aaaatttatt
      661 gcatataaaa gaatgatgac gaaaatatag aaaatgtgca taacattta