Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable alpha-aspartyl dipeptidase


LOCUS       XM_013249835            1055 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085533), mRNA.
ACCESSION   XM_013249835
VERSION     XM_013249835.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249835.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1055
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1055
                     /gene="LOC106085533"
                     /note="probable alpha-aspartyl dipeptidase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:106085533"
     CDS             170..907
                     /gene="LOC106085533"
                     /codon_start=1
                     /product="probable alpha-aspartyl dipeptidase"
                     /protein_id="XP_013105289.1"
                     /db_xref="GeneID:106085533"
                     /translation="MQKVVPMAERAILLLSSSRVHGYGYLEHAKPQIVDFLKRKNVES
                     ILFVPYALIDHDKYTATVSAALTPWGYKVEGIHTKKCPVEAISSAQAIFVGGGNTFVL
                     LKTLYEKKLIDPLRQQVLHKGIPYMGSSAGTNVATRSINTTNDMPVVYPPSFEALRLV
                     PFNINPHYLETDPHTEHKGETRDERLNEYLEYAKLPVLGLREGTALLVQGDKATLVGD
                     RKAKLFRPNAEPVEYEPNSDLSFLLQL"
     misc_feature    203..898
                     /gene="LOC106085533"
                     /note="dipeptidase PepE; Region: PRK05282"
                     /db_xref="CDD:179990"
     misc_feature    order(458..460,557..559,602..604,668..670,713..715,
                     773..775)
                     /gene="LOC106085533"
                     /note="active site pocket [active]"
                     /db_xref="CDD:153240"
     misc_feature    order(458..460,560..562)
                     /gene="LOC106085533"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:153240"
     misc_feature    order(557..559,668..670,773..775)
                     /gene="LOC106085533"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153240"
     misc_feature    557..559
                     /gene="LOC106085533"
                     /note="active site nucleophile [active]"
                     /db_xref="CDD:153240"
     polyA_site      1055
                     /gene="LOC106085533"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agtgtaatca gctgtacgta ttatagacat tggaattgct tgtttgtttc aagttgtcat
       61 gtgtgcaatg gattggattg caaatagttt tatcagctaa aagaaatatc acagcaaagc
      121 gataagtctt caatttacaa ttgtcgattt agtttggaaa aatttttgaa tgcagaaggt
      181 agttccaatg gctgaaagag ctatactgct gttatcctct tcacgggttc atggctatgg
      241 atatttggag catgccaaac cgcagattgt ggactttttg aaaagaaaaa atgtcgaatc
      301 cattttgttt gtaccatatg ccttaataga tcacgacaaa tatacagcca cggtgagtgc
      361 agccttaaca ccatgggggt acaaagtgga gggcattcat acaaagaaat gcccagtgga
      421 agccatttca tcggcccaag ccatatttgt gggtggtggc aacacgtttg ttcttttgaa
      481 aaccttgtac gagaagaaac tcattgaccc tttgaggcaa caagttttgc ataaaggtat
      541 tccatatatg ggcagcagtg cgggcacaaa tgtggccaca cgctctatta acaccaccaa
      601 tgatatgcct gtggtgtatc caccttcatt cgaggctcta cgtttggttc cattcaatat
      661 aaatccacat tatttggaga ccgatccaca tactgagcac aagggcgaaa caagagatga
      721 gcgtttgaat gaatatctcg agtatgccaa attgcctgtc cttgggttac gagaaggcac
      781 tgcactatta gtgcaaggtg ataaggccac cctagtaggc gatagaaaag ctaaactctt
      841 taggcccaat gctgaacctg tagaatatga gcccaattcg gatttaagct ttttattgca
      901 actataaaaa tccagtgttg gcgatagagt atctatctat ggttatcatc tatcgacaac
      961 aagaattaaa ttgatagtaa tgtgtaaatg ttatgcacat tttctatatt ttcgtcatca
     1021 ttcttttata tgcaataaat tttatttttt gtgca