Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249835 1055 bp mRNA linear INV 02-SEP-2023 (LOC106085533), mRNA. ACCESSION XM_013249835 VERSION XM_013249835.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249835.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1055 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1055 /gene="LOC106085533" /note="probable alpha-aspartyl dipeptidase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106085533" CDS 170..907 /gene="LOC106085533" /codon_start=1 /product="probable alpha-aspartyl dipeptidase" /protein_id="XP_013105289.1" /db_xref="GeneID:106085533" /translation="MQKVVPMAERAILLLSSSRVHGYGYLEHAKPQIVDFLKRKNVES ILFVPYALIDHDKYTATVSAALTPWGYKVEGIHTKKCPVEAISSAQAIFVGGGNTFVL LKTLYEKKLIDPLRQQVLHKGIPYMGSSAGTNVATRSINTTNDMPVVYPPSFEALRLV PFNINPHYLETDPHTEHKGETRDERLNEYLEYAKLPVLGLREGTALLVQGDKATLVGD RKAKLFRPNAEPVEYEPNSDLSFLLQL" misc_feature 203..898 /gene="LOC106085533" /note="dipeptidase PepE; Region: PRK05282" /db_xref="CDD:179990" misc_feature order(458..460,557..559,602..604,668..670,713..715, 773..775) /gene="LOC106085533" /note="active site pocket [active]" /db_xref="CDD:153240" misc_feature order(458..460,560..562) /gene="LOC106085533" /note="oxyanion hole [active]" /db_xref="CDD:153240" misc_feature order(557..559,668..670,773..775) /gene="LOC106085533" /note="catalytic triad [active]" /db_xref="CDD:153240" misc_feature 557..559 /gene="LOC106085533" /note="active site nucleophile [active]" /db_xref="CDD:153240" polyA_site 1055 /gene="LOC106085533" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agtgtaatca gctgtacgta ttatagacat tggaattgct tgtttgtttc aagttgtcat 61 gtgtgcaatg gattggattg caaatagttt tatcagctaa aagaaatatc acagcaaagc 121 gataagtctt caatttacaa ttgtcgattt agtttggaaa aatttttgaa tgcagaaggt 181 agttccaatg gctgaaagag ctatactgct gttatcctct tcacgggttc atggctatgg 241 atatttggag catgccaaac cgcagattgt ggactttttg aaaagaaaaa atgtcgaatc 301 cattttgttt gtaccatatg ccttaataga tcacgacaaa tatacagcca cggtgagtgc 361 agccttaaca ccatgggggt acaaagtgga gggcattcat acaaagaaat gcccagtgga 421 agccatttca tcggcccaag ccatatttgt gggtggtggc aacacgtttg ttcttttgaa 481 aaccttgtac gagaagaaac tcattgaccc tttgaggcaa caagttttgc ataaaggtat 541 tccatatatg ggcagcagtg cgggcacaaa tgtggccaca cgctctatta acaccaccaa 601 tgatatgcct gtggtgtatc caccttcatt cgaggctcta cgtttggttc cattcaatat 661 aaatccacat tatttggaga ccgatccaca tactgagcac aagggcgaaa caagagatga 721 gcgtttgaat gaatatctcg agtatgccaa attgcctgtc cttgggttac gagaaggcac 781 tgcactatta gtgcaaggtg ataaggccac cctagtaggc gatagaaaag ctaaactctt 841 taggcccaat gctgaacctg tagaatatga gcccaattcg gatttaagct ttttattgca 901 actataaaaa tccagtgttg gcgatagagt atctatctat ggttatcatc tatcgacaac 961 aagaattaaa ttgatagtaa tgtgtaaatg ttatgcacat tttctatatt ttcgtcatca 1021 ttcttttata tgcaataaat tttatttttt gtgca