Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249817 508 bp mRNA linear INV 02-SEP-2023 auxiliary subunit (LOC106085522), mRNA. ACCESSION XM_013249817 VERSION XM_013249817.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249817.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..508 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..508 /gene="LOC106085522" /note="N-alpha-acetyltransferase 38, NatC auxiliary subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106085522" CDS 102..449 /gene="LOC106085522" /codon_start=1 /product="N-alpha-acetyltransferase 38, NatC auxiliary subunit" /protein_id="XP_013105271.1" /db_xref="GeneID:106085522" /translation="MNDLTNPKQYENPLLNNVITNNAKINDEHLSPGIRNLRKWLGKP FRVVITDGRVLVGFFNCTDKDSNIVLSMCAEYLEEGQDARILGNVMIPGKHIVSVSVD MPADKVYASKPMS" misc_feature 201..407 /gene="LOC106085522" /note="LSM domain containing 1; Region: LSMD1; cd06168" /db_xref="CDD:212486" misc_feature order(234..254,258..296,300..314) /gene="LOC106085522" /note="Sm1 motif; other site" /db_xref="CDD:212486" misc_feature order(288..290,294..296,375..377) /gene="LOC106085522" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:212486" misc_feature 363..398 /gene="LOC106085522" /note="Sm2 motif; other site" /db_xref="CDD:212486" polyA_site 508 /gene="LOC106085522" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cagctgtttt gtgtttttat ttaggaatac acaaattata atttctatac aacaactaaa 61 gtccaccaaa gtccccttat agctcttcaa taaactaaca aatgaacgat ttaacaaatc 121 ctaaacaata tgagaaccct ttgctcaata atgtcattac caacaatgcc aaaatcaacg 181 atgaacatct aagtcctggc atacgaaatc taagaaaatg gctgggaaaa ccttttcgag 241 ttgtgataac ggatggccga gttttagttg gtttcttcaa ttgcaccgac aaagattcta 301 atatagtatt gtccatgtgt gccgaatact tggaagaggg tcaggatgcc cgtattttag 361 gaaatgttat gattcccggt aaacatatag tctctgtatc tgtagatatg cccgccgata 421 aggtatatgc atcaaaaccc atgtcttagt agtttttagt ttattttaaa ataacaaaat 481 acatacatat tttttttaat taagagta