Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans N-alpha-acetyltransferase 38, NatC


LOCUS       XM_013249817             508 bp    mRNA    linear   INV 02-SEP-2023
            auxiliary subunit (LOC106085522), mRNA.
ACCESSION   XM_013249817
VERSION     XM_013249817.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249817.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..508
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..508
                     /gene="LOC106085522"
                     /note="N-alpha-acetyltransferase 38, NatC auxiliary
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:106085522"
     CDS             102..449
                     /gene="LOC106085522"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 38, NatC auxiliary
                     subunit"
                     /protein_id="XP_013105271.1"
                     /db_xref="GeneID:106085522"
                     /translation="MNDLTNPKQYENPLLNNVITNNAKINDEHLSPGIRNLRKWLGKP
                     FRVVITDGRVLVGFFNCTDKDSNIVLSMCAEYLEEGQDARILGNVMIPGKHIVSVSVD
                     MPADKVYASKPMS"
     misc_feature    201..407
                     /gene="LOC106085522"
                     /note="LSM domain containing 1; Region: LSMD1; cd06168"
                     /db_xref="CDD:212486"
     misc_feature    order(234..254,258..296,300..314)
                     /gene="LOC106085522"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212486"
     misc_feature    order(288..290,294..296,375..377)
                     /gene="LOC106085522"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212486"
     misc_feature    363..398
                     /gene="LOC106085522"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212486"
     polyA_site      508
                     /gene="LOC106085522"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cagctgtttt gtgtttttat ttaggaatac acaaattata atttctatac aacaactaaa
       61 gtccaccaaa gtccccttat agctcttcaa taaactaaca aatgaacgat ttaacaaatc
      121 ctaaacaata tgagaaccct ttgctcaata atgtcattac caacaatgcc aaaatcaacg
      181 atgaacatct aagtcctggc atacgaaatc taagaaaatg gctgggaaaa ccttttcgag
      241 ttgtgataac ggatggccga gttttagttg gtttcttcaa ttgcaccgac aaagattcta
      301 atatagtatt gtccatgtgt gccgaatact tggaagaggg tcaggatgcc cgtattttag
      361 gaaatgttat gattcccggt aaacatatag tctctgtatc tgtagatatg cccgccgata
      421 aggtatatgc atcaaaaccc atgtcttagt agtttttagt ttattttaaa ataacaaaat
      481 acatacatat tttttttaat taagagta