PREDICTED: Stomoxys calcitrans tRNA

LOCUS       XM_013249815            1061 bp    mRNA    linear   INV 02-SEP-2023
            (cytosine(38)-C(5))-methyltransferase (LOC106085525), mRNA.
ACCESSION   XM_013249815
VERSION     XM_013249815.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; corrected model.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249815.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-98                OY720438.1         71711490-71711587   c
            99-841              OY720438.1         71710689-71711431   c
            842-1061            OY720438.1         71710468-71710687   c
FEATURES             Location/Qualifiers
     source          1..1061
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1061
                     /gene="LOC106085525"
                     /note="tRNA (cytosine(38)-C(5))-methyltransferase; The
                     sequence of the model RefSeq transcript was modified
                     relative to its source genomic sequence to represent the
                     inferred CDS: deleted 1 base in 1 codon; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:106085525"
     CDS             38..1060
                     /gene="LOC106085525"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: tRNA
                     (cytosine(38)-C(5))-methyltransferase"
                     /protein_id="XP_013105269.2"
                     /db_xref="GeneID:106085525"
                     /translation="MELHILELFSGIGGMHYAFECSKLKGHICAAMDINTVANNVYFY
                     NHPNTPVMNNNIQKLSVKTLQKLGVNTILMSPPCQPHTRVGQKRDVEDKRSDALNHIC
                     ELLPKCTDVQYILMENVKGFEESTAREKYIEALEKSGFYFREFILTPTQIGIPNTRHR
                     YYCIARRRKDFSFPAGKIWTCLSTESQMTYEATNLSDLLMEDTLCSEYLLDEKVLKKR
                     VWLLDIVTRHATNTMCFTKAYTHYSEGTGSIYCPLSLDEMKTIFANLKKTEYSDNCED
                     AANWELLQRLRLRYFSPREVSRLMSFPETFNFPLETSNRQKYRLLGNSINVRLVGELI
                     KIMCKE"
     polyA_site      1061
                     /gene="LOC106085525"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagcaaatcc aattttgttt agttgattgt aataaaaatg gaattacata ttttggaact
       61 tttcagcgga attggaggaa tgcactatgc ttttgaatgc tccaagctta aaggacacat
      121 ttgtgctgca atggacataa acacggtggc gaacaatgta tatttctaca atcacccaaa
      181 cactcctgtg atgaacaaca acattcaaaa acttagcgta aagactttgc aaaaacttgg
      241 agttaatacc atcttaatgt caccaccatg tcaacctcac acacgtgttg gtcaaaaacg
      301 tgatgtcgaa gacaaacgtt cagatgctct taatcacata tgcgagttgc tgcctaagtg
      361 taccgatgta caatatattc ttatggaaaa cgttaaaggt tttgaggagt ccacagccag
      421 agaaaagtat attgaagcac tggagaaatc aggcttctac ttccgagagt tcatattgac
      481 tcccacacaa ataggaattc caaatacaag gcatcgttat tattgcatag caagaaggag
      541 gaaagatttc tcatttccag ctggtaaaat atggacttgt ctttcgacag aatcacaaat
      601 gacatatgag gccacaaatt taagcgattt gcttatggaa gatacattat gttctgaata
      661 tcttttggat gaaaaagtac ttaaaaaaag ggtatggctg ctagacattg ttacccgcca
      721 tgcaacaaat accatgtgtt ttaccaaagc gtatacccac tatagtgagg gaacaggatc
      781 aatttattgt cccttgagtt tggatgaaat gaaaacaata tttgcaaatc taaaaaaaac
      841 tgaatacagt gacaattgtg aagatgcggc aaattgggaa cttttacaaa ggttgaggct
      901 gagatatttc tcacctcggg aagtttcaag attgatgagt tttcccgaaa ctttcaattt
      961 cccgctcgaa acatcaaatc gtcagaaata ccgtttactg ggaaatagca taaatgttcg
     1021 tcttgttggt gaattaataa aaataatgtg caaagaataa a