Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans N-alpha-acetyltransferase 38, NatC


LOCUS       XM_013249809             506 bp    mRNA    linear   INV 02-SEP-2023
            auxiliary subunit-like (LOC131993963), mRNA.
ACCESSION   XM_013249809
VERSION     XM_013249809.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249809.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..506
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..506
                     /gene="LOC131993963"
                     /note="N-alpha-acetyltransferase 38, NatC auxiliary
                     subunit-like; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:131993963"
     CDS             76..429
                     /gene="LOC131993963"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 38, NatC auxiliary
                     subunit-like"
                     /protein_id="XP_013105263.1"
                     /db_xref="GeneID:131993963"
                     /translation="MNDLTNPKQYENPLLNNVITNNSNISDEHLSPGKRNLRNWLGKP
                     FRIVITDGRVLVGFFNCTDKDSNIVLSMCAEYLEEGQDARILGNVMIPGKHIVSVSVD
                     MPAQAVLLGLPQRHR"
     misc_feature    184..381
                     /gene="LOC131993963"
                     /note="LSM domain containing 1; Region: LSMD1; cd06168"
                     /db_xref="CDD:212486"
     misc_feature    order(208..228,232..270,274..288)
                     /gene="LOC131993963"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212486"
     misc_feature    order(262..264,268..270,349..351)
                     /gene="LOC131993963"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212486"
     misc_feature    337..372
                     /gene="LOC131993963"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212486"
     polyA_site      506
                     /gene="LOC131993963"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgttttgtgt ttttatatta ccaaaatcca acaaaagcat tcgggtctcc ttacagttta
       61 caaaaaaact aagaaatgaa cgatttgaca aatcctaaac aatatgagaa ccctttgctc
      121 aataatgtca ttaccaacaa ttccaatatc agcgatgaac atctaagtcc aggcaaacga
      181 aatctaagaa actggctggg aaaacctttt agaatcgtaa ttacggatgg ccgagtttta
      241 gtaggtttct tcaactgtac cgacaaagat tctaatattg tattgtccat gtgtgccgaa
      301 tacttggagg aaggtcagga tgcccgtatt ttaggaaatg taatgattcc cggtaaacat
      361 atagtctctg tatctgtaga tatgcctgcc caagccgttt tattagggtt gccgcaacgg
      421 cacagataag ggaacttgat atgccaattc atttttgaat tcgccttaca aaaatataaa
      481 ctttaaaaat atatttaata cctaaa