Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249809 506 bp mRNA linear INV 02-SEP-2023 auxiliary subunit-like (LOC131993963), mRNA. ACCESSION XM_013249809 VERSION XM_013249809.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249809.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..506 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..506 /gene="LOC131993963" /note="N-alpha-acetyltransferase 38, NatC auxiliary subunit-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:131993963" CDS 76..429 /gene="LOC131993963" /codon_start=1 /product="N-alpha-acetyltransferase 38, NatC auxiliary subunit-like" /protein_id="XP_013105263.1" /db_xref="GeneID:131993963" /translation="MNDLTNPKQYENPLLNNVITNNSNISDEHLSPGKRNLRNWLGKP FRIVITDGRVLVGFFNCTDKDSNIVLSMCAEYLEEGQDARILGNVMIPGKHIVSVSVD MPAQAVLLGLPQRHR" misc_feature 184..381 /gene="LOC131993963" /note="LSM domain containing 1; Region: LSMD1; cd06168" /db_xref="CDD:212486" misc_feature order(208..228,232..270,274..288) /gene="LOC131993963" /note="Sm1 motif; other site" /db_xref="CDD:212486" misc_feature order(262..264,268..270,349..351) /gene="LOC131993963" /note="putative RNA binding site [nucleotide binding]; other site" /db_xref="CDD:212486" misc_feature 337..372 /gene="LOC131993963" /note="Sm2 motif; other site" /db_xref="CDD:212486" polyA_site 506 /gene="LOC131993963" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgttttgtgt ttttatatta ccaaaatcca acaaaagcat tcgggtctcc ttacagttta 61 caaaaaaact aagaaatgaa cgatttgaca aatcctaaac aatatgagaa ccctttgctc 121 aataatgtca ttaccaacaa ttccaatatc agcgatgaac atctaagtcc aggcaaacga 181 aatctaagaa actggctggg aaaacctttt agaatcgtaa ttacggatgg ccgagtttta 241 gtaggtttct tcaactgtac cgacaaagat tctaatattg tattgtccat gtgtgccgaa 301 tacttggagg aaggtcagga tgcccgtatt ttaggaaatg taatgattcc cggtaaacat 361 atagtctctg tatctgtaga tatgcctgcc caagccgttt tattagggtt gccgcaacgg 421 cacagataag ggaacttgat atgccaattc atttttgaat tcgccttaca aaaatataaa 481 ctttaaaaat atatttaata cctaaa