Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249736 1023 bp mRNA linear INV 02-SEP-2023 (LOC106085455), transcript variant X3, mRNA. ACCESSION XM_013249736 VERSION XM_013249736.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249736.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1023 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1023 /gene="LOC106085455" /note="uncharacterized LOC106085455; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085455" CDS 78..809 /gene="LOC106085455" /codon_start=1 /product="uncharacterized protein LOC106085455 isoform X3" /protein_id="XP_013105190.1" /db_xref="GeneID:106085455" /translation="MDKLIWPKEAILEMIAMWKNNECLYNPRNRFYHKKKCRNDVLTE IAERMKAYNIKVGPNQVRNKLQYLRGQFTRELAKARESQNAVNPDDVYVPCTYWFKEL DFLLDYVKVRKEKSNFNSLQQHYSQFEEDTYESSQAHESDVSAEEPIKKVKRRHHTPV ASCSMKNEEVVVEPEVNVLPHVFSVNKTSSNEKDEAFCNFIKSELQTITNENVRDELV ETITLALFEAKKKQRMYAHAAEQYY" misc_feature 120..392 /gene="LOC106085455" /note="Alcohol dehydrogenase transcription factor Myb/SANT-like; Region: MADF_DNA_bdg; pfam10545" /db_xref="CDD:463144" polyA_site 1023 /gene="LOC106085455" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gattagagcg cgctgttgtt tggttggaaa acaaaaaaca ttttttgttg tatgtaggta 61 caaaaaatta aaacaaaatg gataaattaa tttggccaaa ggaagcgatt ctggaaatga 121 ttgcaatgtg gaaaaataat gagtgtctgt acaatccaag gaatagattt tatcacaaga 181 agaagtgcag aaatgatgtg ttaactgaga tagcagaaag gatgaaggca tataacataa 241 aagttgggcc aaaccaggta aggaataaac ttcagtattt gcgtggacag tttactcggg 301 agcttgccaa agccagagaa tctcaaaatg cagtaaatcc agatgatgta tatgtcccat 361 gtacctactg gttcaaggag ttagatttct tgcttgacta tgtaaaagta agaaaagaaa 421 agtccaactt caattcattg caacaacact attcacagtt tgaggaggac acttatgaat 481 catcgcaagc tcatgaaagc gatgtatctg cagaagaacc aattaaaaaa gtcaaacgaa 541 gacatcatac gccggtagca agctgcagca tgaaaaacga agaggttgta gtggaaccag 601 aagtcaatgt cctgccacat gtattcagtg tcaataagac ttcttcgaat gaaaaggatg 661 aagctttttg taattttatc aaatcggaac tacaaactat tactaatgaa aatgtaaggg 721 atgaattggt agagactatc acgttagcgc tattcgaagc caagaagaaa caacgcatgt 781 atgcccacgc agcggagcaa tattattgat ttcagtccaa ttttagagtt atacttccgt 841 aatattattt tatatcagtt gatttgaagt gagtttagta aatgtgagtt gtgctaattt 901 aattgcgaat cttaaaatcc tttttcaaaa aaatggatgt gagcaaatat cgatttcgtt 961 gtgtgcttgg gttttgtata attttttttt ataagttaaa ataaaccgaa aattttcgtg 1021 taa