Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249710 1012 bp mRNA linear INV 02-SEP-2023 (LOC106085455), transcript variant X1, mRNA. ACCESSION XM_013249710 VERSION XM_013249710.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249710.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1012 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1012 /gene="LOC106085455" /note="uncharacterized LOC106085455; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085455" CDS 1..798 /gene="LOC106085455" /codon_start=1 /product="uncharacterized protein LOC106085455 isoform X1" /protein_id="XP_013105164.1" /db_xref="GeneID:106085455" /translation="MDKVSSFIFLWIIINLLIQLFDLLQLIWPKEAILEMIAMWKNNE CLYNPRNRFYHKKKCRNDVLTEIAERMKAYNIKVGPNQVRNKLQYLRGQFTRELAKAR ESQNAVNPDDVYVPCTYWFKELDFLLDYVKVRKEKSNFNSLQQHYSQFEEDTYESSQA HESDVSAEEPIKKVKRRHHTPVASCSMKNEEVVVEPEVNVLPHVFSVNKTSSNEKDEA FCNFIKSELQTITNENVRDELVETITLALFEAKKKQRMYAHAAEQYY" misc_feature 109..381 /gene="LOC106085455" /note="Alcohol dehydrogenase transcription factor Myb/SANT-like; Region: MADF_DNA_bdg; pfam10545" /db_xref="CDD:463144" polyA_site 1012 /gene="LOC106085455" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atggataaag tgagtagttt tatttttttg tggattatta ttaacttact aatacaatta 61 tttgatttat tgcagttaat ttggccaaag gaagcgattc tggaaatgat tgcaatgtgg 121 aaaaataatg agtgtctgta caatccaagg aatagatttt atcacaagaa gaagtgcaga 181 aatgatgtgt taactgagat agcagaaagg atgaaggcat ataacataaa agttgggcca 241 aaccaggtaa ggaataaact tcagtatttg cgtggacagt ttactcggga gcttgccaaa 301 gccagagaat ctcaaaatgc agtaaatcca gatgatgtat atgtcccatg tacctactgg 361 ttcaaggagt tagatttctt gcttgactat gtaaaagtaa gaaaagaaaa gtccaacttc 421 aattcattgc aacaacacta ttcacagttt gaggaggaca cttatgaatc atcgcaagct 481 catgaaagcg atgtatctgc agaagaacca attaaaaaag tcaaacgaag acatcatacg 541 ccggtagcaa gctgcagcat gaaaaacgaa gaggttgtag tggaaccaga agtcaatgtc 601 ctgccacatg tattcagtgt caataagact tcttcgaatg aaaaggatga agctttttgt 661 aattttatca aatcggaact acaaactatt actaatgaaa atgtaaggga tgaattggta 721 gagactatca cgttagcgct attcgaagcc aagaagaaac aacgcatgta tgcccacgca 781 gcggagcaat attattgatt tcagtccaat tttagagtta tacttccgta atattatttt 841 atatcagttg atttgaagtg agtttagtaa atgtgagttg tgctaattta attgcgaatc 901 ttaaaatcct ttttcaaaaa aatggatgtg agcaaatatc gatttcgttg tgtgcttggg 961 ttttgtataa ttttttttta taagttaaaa taaaccgaaa attttcgtgt aa