Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085455


LOCUS       XM_013249710            1012 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085455), transcript variant X1, mRNA.
ACCESSION   XM_013249710
VERSION     XM_013249710.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249710.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1012
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1012
                     /gene="LOC106085455"
                     /note="uncharacterized LOC106085455; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085455"
     CDS             1..798
                     /gene="LOC106085455"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085455 isoform X1"
                     /protein_id="XP_013105164.1"
                     /db_xref="GeneID:106085455"
                     /translation="MDKVSSFIFLWIIINLLIQLFDLLQLIWPKEAILEMIAMWKNNE
                     CLYNPRNRFYHKKKCRNDVLTEIAERMKAYNIKVGPNQVRNKLQYLRGQFTRELAKAR
                     ESQNAVNPDDVYVPCTYWFKELDFLLDYVKVRKEKSNFNSLQQHYSQFEEDTYESSQA
                     HESDVSAEEPIKKVKRRHHTPVASCSMKNEEVVVEPEVNVLPHVFSVNKTSSNEKDEA
                     FCNFIKSELQTITNENVRDELVETITLALFEAKKKQRMYAHAAEQYY"
     misc_feature    109..381
                     /gene="LOC106085455"
                     /note="Alcohol dehydrogenase transcription factor
                     Myb/SANT-like; Region: MADF_DNA_bdg; pfam10545"
                     /db_xref="CDD:463144"
     polyA_site      1012
                     /gene="LOC106085455"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggataaag tgagtagttt tatttttttg tggattatta ttaacttact aatacaatta
       61 tttgatttat tgcagttaat ttggccaaag gaagcgattc tggaaatgat tgcaatgtgg
      121 aaaaataatg agtgtctgta caatccaagg aatagatttt atcacaagaa gaagtgcaga
      181 aatgatgtgt taactgagat agcagaaagg atgaaggcat ataacataaa agttgggcca
      241 aaccaggtaa ggaataaact tcagtatttg cgtggacagt ttactcggga gcttgccaaa
      301 gccagagaat ctcaaaatgc agtaaatcca gatgatgtat atgtcccatg tacctactgg
      361 ttcaaggagt tagatttctt gcttgactat gtaaaagtaa gaaaagaaaa gtccaacttc
      421 aattcattgc aacaacacta ttcacagttt gaggaggaca cttatgaatc atcgcaagct
      481 catgaaagcg atgtatctgc agaagaacca attaaaaaag tcaaacgaag acatcatacg
      541 ccggtagcaa gctgcagcat gaaaaacgaa gaggttgtag tggaaccaga agtcaatgtc
      601 ctgccacatg tattcagtgt caataagact tcttcgaatg aaaaggatga agctttttgt
      661 aattttatca aatcggaact acaaactatt actaatgaaa atgtaaggga tgaattggta
      721 gagactatca cgttagcgct attcgaagcc aagaagaaac aacgcatgta tgcccacgca
      781 gcggagcaat attattgatt tcagtccaat tttagagtta tacttccgta atattatttt
      841 atatcagttg atttgaagtg agtttagtaa atgtgagttg tgctaattta attgcgaatc
      901 ttaaaatcct ttttcaaaaa aatggatgtg agcaaatatc gatttcgttg tgtgcttggg
      961 ttttgtataa ttttttttta taagttaaaa taaaccgaaa attttcgtgt aa