Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085300


LOCUS       XM_013249501             951 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085300), transcript variant X2, mRNA.
ACCESSION   XM_013249501
VERSION     XM_013249501.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249501.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..951
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..951
                     /gene="LOC106085300"
                     /note="uncharacterized LOC106085300; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085300"
     CDS             144..851
                     /gene="LOC106085300"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085300"
                     /protein_id="XP_013104955.1"
                     /db_xref="GeneID:106085300"
                     /translation="METTKETSNEACAKDAGEMKLKCFVIIVGFDLSRDGLKEDIERI
                     KNTFRRLFDATILILENKTKKEIMKEYRNLFLNKHTFAEYKFVAVFCLSHGLDDGQLI
                     LNPGREIVDAQRLLLNPFFKFEQLDQKLKWLVVQSCRGDLNDYRPLQHDGITGVFPDF
                     HFISYCTGEGTVSFQLNTEGKIYIQTLCKELETNVREKSLCEMLDNVNLSFVNLGIAQ
                     PARPDYKKNVNDYRFYE"
     misc_feature    243..776
                     /gene="LOC106085300"
                     /note="Caspase domain; Region: Peptidase_C14; pfam00656"
                     /db_xref="CDD:425803"
     misc_feature    order(243..245,426..428,549..551,570..572,657..674,
                     684..689)
                     /gene="LOC106085300"
                     /note="substrate pocket [chemical binding]; other site"
                     /db_xref="CDD:237997"
     misc_feature    order(423..425,555..557)
                     /gene="LOC106085300"
                     /note="active site"
                     /db_xref="CDD:237997"
     polyA_site      951
                     /gene="LOC106085300"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatataaaag aaggtcaata gtgcggataa aaattggttt gttattattg gatattttaa
       61 cccaataggg caaagtgtcc gtattcattt gtgtgaaaat tttggaaaac catatagaaa
      121 agaattcttg tttactaata caaatggaaa caactaaaga aacgtccaac gaagcatgcg
      181 cgaaagatgc cggtgaaatg aagttaaaat gctttgttat tattgtcgga tttgacttaa
      241 gcagagatgg cttgaaggaa gatattgaac gaatcaaaaa cacttttagg aggttgtttg
      301 atgctacaat tctgattttg gaaaataaaa ccaaaaaaga aataatgaag gaatatagga
      361 atttgttttt gaataaacat acattcgccg aatataagtt tgtagcagta ttttgcctca
      421 gccatggact agacgacggc caacttattc taaatcctgg ccgagaaatt gttgatgccc
      481 aacggttatt gcttaatcca ttttttaaat ttgagcagtt ggaccagaaa ttgaagtggc
      541 tggtggtaca aagttgccgc ggagatctaa acgattaccg acccttacaa catgatggca
      601 taacaggggt tttcccggat ttccacttta tctcgtattg tacaggggag ggaactgtca
      661 gctttcaact gaacaccgaa ggaaaaattt atatacaaac tctgtgtaaa gaactcgaaa
      721 caaatgttcg agaaaaaagt ttgtgcgaaa tgcttgacaa cgtcaacttg tcttttgtaa
      781 atctaggcat agcccaaccg gcaagaccag actacaagaa aaacgtcaac gactataggt
      841 tttacgaata aaaataagga aaccattgta aaaaagaaac attttaacaa acatttaaca
      901 caataaagat attaaacatg tgcataaaca acatacaatt gccagaatga a