Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249501 951 bp mRNA linear INV 02-SEP-2023 (LOC106085300), transcript variant X2, mRNA. ACCESSION XM_013249501 VERSION XM_013249501.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249501.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..951 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..951 /gene="LOC106085300" /note="uncharacterized LOC106085300; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085300" CDS 144..851 /gene="LOC106085300" /codon_start=1 /product="uncharacterized protein LOC106085300" /protein_id="XP_013104955.1" /db_xref="GeneID:106085300" /translation="METTKETSNEACAKDAGEMKLKCFVIIVGFDLSRDGLKEDIERI KNTFRRLFDATILILENKTKKEIMKEYRNLFLNKHTFAEYKFVAVFCLSHGLDDGQLI LNPGREIVDAQRLLLNPFFKFEQLDQKLKWLVVQSCRGDLNDYRPLQHDGITGVFPDF HFISYCTGEGTVSFQLNTEGKIYIQTLCKELETNVREKSLCEMLDNVNLSFVNLGIAQ PARPDYKKNVNDYRFYE" misc_feature 243..776 /gene="LOC106085300" /note="Caspase domain; Region: Peptidase_C14; pfam00656" /db_xref="CDD:425803" misc_feature order(243..245,426..428,549..551,570..572,657..674, 684..689) /gene="LOC106085300" /note="substrate pocket [chemical binding]; other site" /db_xref="CDD:237997" misc_feature order(423..425,555..557) /gene="LOC106085300" /note="active site" /db_xref="CDD:237997" polyA_site 951 /gene="LOC106085300" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatataaaag aaggtcaata gtgcggataa aaattggttt gttattattg gatattttaa 61 cccaataggg caaagtgtcc gtattcattt gtgtgaaaat tttggaaaac catatagaaa 121 agaattcttg tttactaata caaatggaaa caactaaaga aacgtccaac gaagcatgcg 181 cgaaagatgc cggtgaaatg aagttaaaat gctttgttat tattgtcgga tttgacttaa 241 gcagagatgg cttgaaggaa gatattgaac gaatcaaaaa cacttttagg aggttgtttg 301 atgctacaat tctgattttg gaaaataaaa ccaaaaaaga aataatgaag gaatatagga 361 atttgttttt gaataaacat acattcgccg aatataagtt tgtagcagta ttttgcctca 421 gccatggact agacgacggc caacttattc taaatcctgg ccgagaaatt gttgatgccc 481 aacggttatt gcttaatcca ttttttaaat ttgagcagtt ggaccagaaa ttgaagtggc 541 tggtggtaca aagttgccgc ggagatctaa acgattaccg acccttacaa catgatggca 601 taacaggggt tttcccggat ttccacttta tctcgtattg tacaggggag ggaactgtca 661 gctttcaact gaacaccgaa ggaaaaattt atatacaaac tctgtgtaaa gaactcgaaa 721 caaatgttcg agaaaaaagt ttgtgcgaaa tgcttgacaa cgtcaacttg tcttttgtaa 781 atctaggcat agcccaaccg gcaagaccag actacaagaa aaacgtcaac gactataggt 841 tttacgaata aaaataagga aaccattgta aaaaagaaac attttaacaa acatttaaca 901 caataaagat attaaacatg tgcataaaca acatacaatt gccagaatga a