Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans transcription factor grauzone-like


LOCUS       XM_013249459            1453 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085281), transcript variant X1, mRNA.
ACCESSION   XM_013249459
VERSION     XM_013249459.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249459.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1453
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1453
                     /gene="LOC106085281"
                     /note="transcription factor grauzone-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106085281"
     CDS             181..1350
                     /gene="LOC106085281"
                     /codon_start=1
                     /product="transcription factor grauzone-like"
                     /protein_id="XP_013104913.1"
                     /db_xref="GeneID:106085281"
                     /translation="MAGSNVCRLCRSSCNDSIRLRDSSGRCNGVYNITKKYFNPKYLD
                     VERGCSTPNAVLCMECWRHISGFNSFQQTILLLLDNLHNDGGQPEEENLTSQEFINAN
                     SLKVEEPSDVITIADDADENEPSSFEVNSVAGFGAGQLVVTDCAVQFSTDVGNIEQNA
                     AGSNGIEYPDEVDPQTREPYDIDDDFEAAGGDVFIVDEFDNWEPEAADSVSSTDDGNG
                     ELVELRTRSESPGNSSPFTSWKDVKKKTNSEIDATIAQWKPLLTCYVCSAQFSQFCDV
                     RTHFNQKHPQKEFYISCCGRKIKYRFRVEEHAIYHLNPQAYQCSLCGRCFSAKSTLEA
                     HEHFQHSIKKKDSASSYTAKCTVCPKTFTYRTGVYHHMKAYHPEEFAKRKTRKRN"
     misc_feature    1060..1113
                     /gene="LOC106085281"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1066..1068,1072..1074,1078..1080,1084..1089,
                     1096..1101,1108..1110,1150..1152,1156..1158,1168..1173,
                     1180..1185,1195..1197,1258..1260,1264..1266,1270..1272,
                     1276..1281,1288..1293)
                     /gene="LOC106085281"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1135..1200
                     /gene="LOC106085281"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    1243..1299
                     /gene="LOC106085281"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     polyA_site      1453
                     /gene="LOC106085281"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttttattta actttgagag atcaaaccag cttgttgtct ataaatttaa tctttgtttt
       61 tcgtgtacgc tgtgtatttc acgagtttct tcgcttttac acgtgtgtat tccaataata
      121 tatctttggt tgaaaaagta gtcgaacaca ttcaatctta ctcgaataaa tgtttacatt
      181 atggcagggt ccaatgtatg tcgcttatgt agaagtagct gtaacgacag tatacggctg
      241 cgtgattcaa gcggtcgatg caatggggtt tataatatca ccaaaaaata tttcaatcca
      301 aagtatctag acgtggaacg tggttgctca acaccaaatg cagtgctgtg catggaatgt
      361 tggcgtcaca tatccggttt caacagtttc caacagacaa ttctgctttt gctggataat
      421 cttcacaatg acggaggaca gcccgaggaa gaaaatttaa catcacaaga gtttattaat
      481 gcaaattctt taaaggtgga agaaccttcc gatgtgatta ctatagcaga tgatgctgat
      541 gaaaatgaac ctagctcttt tgaagtaaat tcggtagccg gttttggcgc aggtcaatta
      601 gtcgtaacag actgtgctgt acaattttcg actgacgtag ggaatattga gcaaaatgct
      661 gccggctcca atggcattga gtatccggac gaagtagatc ctcaaaccag agagccatat
      721 gatatcgatg atgatttcga agcggcaggt ggagatgttt ttattgtgga tgagtttgac
      781 aattgggaac cggaagcagc tgattccgta tcaagtacgg atgatggaaa tggtgagtta
      841 gtggaactaa gaaccaggtc agaatctcct ggaaactcat cgccctttac ctcctggaag
      901 gatgtaaaaa agaaaacaaa ttcagaaatc gatgcaacta tagcccaatg gaagccacta
      961 ttgacgtgct atgtttgctc agcacaattt tcacaatttt gtgacgttag gacgcacttt
     1021 aatcagaagc acccccaaaa ggaattttac atttcatgtt gtggtcgcaa aatcaaatac
     1081 cgcttccgcg tcgaggaaca tgccatctat caccttaatc cccaggcata ccaatgtagt
     1141 ttatgtggaa gatgtttttc cgcaaaatcc acattagagg cgcacgagca ttttcaacat
     1201 tccatcaaaa agaaggattc cgccagttca tatactgcga aatgtactgt ttgtccaaag
     1261 acctttacat atcgtaccgg cgtttaccac catatgaaag cataccatcc cgaagagttt
     1321 gccaagcgaa aaacaagaaa acgtaattaa taattgtgtc tagttagaag aataagttct
     1381 tactagttat aagaatagtc cgtacttagt gtattaaaat aaataatttt aaaaagaatg
     1441 gtctcatgca aca