Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans serine/threonine-protein phosphatase


LOCUS       XM_013249350            1411 bp    mRNA    linear   INV 02-SEP-2023
            6 catalytic subunit (LOC106085223), mRNA.
ACCESSION   XM_013249350
VERSION     XM_013249350.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249350.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1411
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1411
                     /gene="LOC106085223"
                     /note="serine/threonine-protein phosphatase 6 catalytic
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 28 Proteins"
                     /db_xref="GeneID:106085223"
     CDS             117..1028
                     /gene="LOC106085223"
                     /codon_start=1
                     /product="serine/threonine-protein phosphatase 6 catalytic
                     subunit"
                     /protein_id="XP_013104804.1"
                     /db_xref="GeneID:106085223"
                     /translation="MADLDKWIELVKDCRYLPENDLKKLCDIVCEILLEESNIQPVST
                     PVTVCGDIHGQFYDLEELFCIGGAIPNTSYIFMGDFVDRGYYSLETLTRLLTLKARYP
                     DRITLLRGNHESRQITKVYGFYDECFSKYGNANAWKYCCKVFDLLAIAAIIDEEVLCV
                     HGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPEEMDYWGQSPRGAGWLFGQMV
                     TKDFMQINNLELICRAHQLVNEGIKYMFDSKLVTVWSAPNYCYRCGNVAAMLNFQTAK
                     DRTTRIFVAVPETDRVIPPHNTTPYFL"
     misc_feature    123..977
                     /gene="LOC106085223"
                     /note="PP2A, PP4, and PP6 phosphoprotein phosphatases,
                     metallophosphatase domain; Region: MPP_PP2A_PP4_PP6;
                     cd07415"
                     /db_xref="CDD:277360"
     misc_feature    order(249..251,297..299,306..311,315..320,324..326,
                     330..335,369..371,414..428,459..464,471..476,486..491,
                     498..503,525..527,900..902,927..929,957..959,975..977)
                     /gene="LOC106085223"
                     /note="heterotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:277360"
     misc_feature    order(267..269,273..275,351..353,363..365,447..452,
                     462..467,477..479,597..599,663..671,696..698,735..743,
                     819..821,825..827,897..905)
                     /gene="LOC106085223"
                     /note="active site"
                     /db_xref="CDD:277360"
     misc_feature    order(267..269,273..275,351..353,447..449,597..599,
                     819..821)
                     /gene="LOC106085223"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:277360"
     polyA_site      1411
                     /gene="LOC106085223"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtgttatcat atcgctgtga atcgtagttg aggttgaaga agagcaagtt aaagggattg
       61 aaaacgcatt tttgcgattt ttttcttaat tttcacaaat aaaaggacgc aagatcatgg
      121 ctgatctaga taagtggatt gaactagtaa aggactgcag atacttaccc gagaatgacc
      181 taaaaaagct ttgtgatatc gtgtgtgaaa ttcttttgga agagtcaaac atacagccag
      241 tcagcacgcc agtgacagtt tgtggtgata tacatgggca gttttatgat ctagaagaat
      301 tattttgtat cggcggtgct attccaaata cgagttacat atttatgggc gatttcgttg
      361 accgagggta ttacagtttg gaaacattga cacgtttact gactctaaag gcacgttatc
      421 ctgatcgtat aactttacta agaggtaatc atgagtcacg gcaaattaca aaggtctatg
      481 gattctatga tgaatgtttt agcaaatatg gtaatgcgaa tgcttggaag tactgctgta
      541 aagttttcga tttattagct atagctgcta taattgacga agaagttcta tgtgtccatg
      601 gtggcttaag tcccgagata ataacattgg atcaaataag aacaatcgat cgaaatggtg
      661 aaattcctta taagggtgca ttctgcgatt tagtatggtc tgatccagaa gaaatggatt
      721 attggggcca aagtccaaga ggagcgggtt ggcttttcgg tcaaatggtt accaaagatt
      781 ttatgcaaat taataacctg gaattaattt gtcgagccca tcagctggtt aacgaaggca
      841 taaaatatat gttcgacagc aaattagtaa cggtatggtc agctccaaac tattgctatc
      901 gttgcggtaa tgtagcggct atgttaaatt tccaaacagc taaggatcgg acaacaagaa
      961 tatttgtggc agtacctgaa acggatcgtg tcataccacc acacaatact acaccatatt
     1021 tcctataagc cgacaaaaag caacaacaaa tacacaggca ttttacattt gcatgtaatg
     1081 cttttgcata ttgccttaaa aaagcggaaa ctataatagt atatcacaat ttaaaaaagt
     1141 tgtattcgaa gaattaagta ttttattggt tttcattttt tcctttccta tcattcttat
     1201 aataccaaca cctacctacc ttatttaata acaaaaaaca aatgaaatta aagactcgtt
     1261 aactcataga tgtctatgtg gctttttgaa tgttagctga tattatttcc attgttcctt
     1321 taatggcggt gtatcaacga attgtgttct tctactgcga tttttcacga aatctttaaa
     1381 taaattataa aacacatttt ttgtacacaa a