Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249338 671 bp mRNA linear INV 02-SEP-2023 (LOC106085212), mRNA. ACCESSION XM_013249338 VERSION XM_013249338.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249338.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..671 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..671 /gene="LOC106085212" /note="uncharacterized LOC106085212; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106085212" CDS 95..466 /gene="LOC106085212" /codon_start=1 /product="uncharacterized protein LOC106085212" /protein_id="XP_013104792.1" /db_xref="GeneID:106085212" /translation="MKFSKISAILLAIFIIGAEATRVRRQDVADANDGDSNAIDDVVA AEDGDTSEVILVDDNLDNGDDEIRDLKTVAIKSRVITLDRELCREQSRYHPHYPKCQL YCENLKHWMGMCRRDTCHCYS" polyA_site 671 /gene="LOC106085212" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatgtttttg atgattttag tttgaaatta aaaggcgaaa cgaaaacaac gttcagaaag 61 tatcacattt tactacttca aaaatttcat tataatgaaa ttctccaaaa tctctgcgat 121 tttgttggca atttttatca ttggtgcgga agccacccgg gtaagacgcc aggatgttgc 181 tgacgccaat gatggcgaca gcaatgccat cgatgatgtt gtggctgccg aagatggcga 241 taccagcgaa gtcatccttg tcgatgacaa cttggacaat ggtgacgatg agatccgaga 301 tttaaaaacg gtggccatca aatcccgcgt cataaccttg gatcgcgaat tgtgtcgcga 361 gcaatcgcgc tatcatcccc actatcccaa atgccagttg tactgtgaga atctcaagca 421 ctggatgggt atgtgtcgtc gcgatacttg ccattgttat tcgtaatttg cgcatgcaac 481 gcttggggaa gcagacagaa atttgtatat aagaaaaaga tacccgccgg agcatgaagg 541 ctttctgtga atgaattact taaaaaacgt atttgtgttt atctttaatt tgcgtgtatg 601 ataattgtcc catgctatgt aaagtgggag agatgtaaaa caaaaaaaaa taataaaatg 661 tattcaatga a