Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085212


LOCUS       XM_013249338             671 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085212), mRNA.
ACCESSION   XM_013249338
VERSION     XM_013249338.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249338.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..671
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..671
                     /gene="LOC106085212"
                     /note="uncharacterized LOC106085212; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106085212"
     CDS             95..466
                     /gene="LOC106085212"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085212"
                     /protein_id="XP_013104792.1"
                     /db_xref="GeneID:106085212"
                     /translation="MKFSKISAILLAIFIIGAEATRVRRQDVADANDGDSNAIDDVVA
                     AEDGDTSEVILVDDNLDNGDDEIRDLKTVAIKSRVITLDRELCREQSRYHPHYPKCQL
                     YCENLKHWMGMCRRDTCHCYS"
     polyA_site      671
                     /gene="LOC106085212"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatgtttttg atgattttag tttgaaatta aaaggcgaaa cgaaaacaac gttcagaaag
       61 tatcacattt tactacttca aaaatttcat tataatgaaa ttctccaaaa tctctgcgat
      121 tttgttggca atttttatca ttggtgcgga agccacccgg gtaagacgcc aggatgttgc
      181 tgacgccaat gatggcgaca gcaatgccat cgatgatgtt gtggctgccg aagatggcga
      241 taccagcgaa gtcatccttg tcgatgacaa cttggacaat ggtgacgatg agatccgaga
      301 tttaaaaacg gtggccatca aatcccgcgt cataaccttg gatcgcgaat tgtgtcgcga
      361 gcaatcgcgc tatcatcccc actatcccaa atgccagttg tactgtgaga atctcaagca
      421 ctggatgggt atgtgtcgtc gcgatacttg ccattgttat tcgtaatttg cgcatgcaac
      481 gcttggggaa gcagacagaa atttgtatat aagaaaaaga tacccgccgg agcatgaagg
      541 ctttctgtga atgaattact taaaaaacgt atttgtgttt atctttaatt tgcgtgtatg
      601 ataattgtcc catgctatgt aaagtgggag agatgtaaaa caaaaaaaaa taataaaatg
      661 tattcaatga a