Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans ribonuclease H2 subunit B


LOCUS       XM_013249321            1152 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085201), mRNA.
ACCESSION   XM_013249321
VERSION     XM_013249321.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249321.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1152
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1152
                     /gene="LOC106085201"
                     /note="ribonuclease H2 subunit B; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106085201"
     CDS             55..1137
                     /gene="LOC106085201"
                     /codon_start=1
                     /product="ribonuclease H2 subunit B"
                     /protein_id="XP_013104775.1"
                     /db_xref="GeneID:106085201"
                     /translation="MSKSKSTRSSKVKDDPDTPAKPKASTSASALRKIFYISQDMLED
                     GTQKLNLEQFYHAGKGKKALFMTKNDNIIMEVVEYSEPRRSWLINSEVCSNGHIYITT
                     PIDVTFLALHHLRKHCSTRAISLDNIYDEEDSSVSRLLTNFIPHASLKCIADVKTAGG
                     DNFYKYNHEKCLAWLSLKTKHVAEALKKAGIYCGHSAISQNYTRSENVVDETAHETDY
                     LRMACDYIGGYISLELHEELAKYLQIPSEKATKNEEKKAAATNTKRKSGDKLKNEISK
                     KQKLENGAAAKLKDSSLLEESPDDDEEENRNKNNSLSEEIIKSPKENLSTPLKEKTMT
                     AKEKSLAKSAKGTKSIASFFMKKTAA"
     misc_feature    154..>609
                     /gene="LOC106085201"
                     /note="Ribonuclease H2-B is a subunit of the eukaryotic
                     RNase H complex which cleaves RNA-DNA hybrids; Region:
                     RNase_H2-B; cd09270"
                     /db_xref="CDD:187751"
     misc_feature    order(160..168,211..213,280..282,304..318)
                     /gene="LOC106085201"
                     /note="heterotrimeric interface; other site"
                     /db_xref="CDD:187751"
ORIGIN      
        1 cccatccttc aaaagaaata gaaatagtcc acaataacta aaaagtgaaa cgaaatgagt
       61 aaatcaaaat caactcgatc cagcaaagta aaagatgatc cggatacacc cgcaaaacca
      121 aaggccagta catctgcatc cgccttaagg aaaatatttt acatatctca ggatatgctg
      181 gaagatggga cgcaaaagtt gaatctggag caattttatc atgcgggaaa aggcaagaaa
      241 gcattattta tgacaaaaaa tgataacatt ataatggaag tggtggagta ttcagagcct
      301 agaagaagtt ggcttatcaa cagcgaggtg tgttccaatg ggcatatcta cattaccacc
      361 ccgattgatg tgaccttttt agctttgcac cacttgcgca agcattgttc gactagagcc
      421 atctccttgg ataacatata tgatgaggag gattccagtg tttcgaggct gcttaccaat
      481 tttataccgc atgcgtcgct aaaatgtatt gccgatgtta aaactgcagg aggagataat
      541 ttctataaat ataaccacga gaaatgttta gcatggttgt cgcttaaaac aaaacatgtg
      601 gcagaggcgt tgaaaaaagc cggcatatac tgtggccaca gtgccatatc gcaaaactat
      661 acacgaagtg aaaacgtagt agacgagact gcccatgaga cggattacct gcgtatggcc
      721 tgtgattata ttgggggcta tatatccctg gaattgcatg aggaacttgc taaatatttg
      781 caaataccct ctgagaaagc gacaaagaat gaggaaaaga aggcagcggc gactaatact
      841 aaacgtaagt ccggcgacaa gctaaagaat gaaatctcga aaaagcaaaa attggaaaat
      901 ggggcagcag ctaaattgaa ggattccagt ttgttggaag aatcgccgga cgatgatgaa
      961 gaagaaaatc gtaataagaa caattcttta agtgaggaga tcataaaatc acccaaagag
     1021 aacttatcta ctccgttgaa ggaaaagaca atgacagcta aagaaaaatc attggcgaag
     1081 agtgctaaag gtaccaagag tatagcatca ttttttatga aaaagactgc cgcataatat
     1141 aatgtagaat gt