Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249321 1152 bp mRNA linear INV 02-SEP-2023 (LOC106085201), mRNA. ACCESSION XM_013249321 VERSION XM_013249321.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249321.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1152 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1152 /gene="LOC106085201" /note="ribonuclease H2 subunit B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106085201" CDS 55..1137 /gene="LOC106085201" /codon_start=1 /product="ribonuclease H2 subunit B" /protein_id="XP_013104775.1" /db_xref="GeneID:106085201" /translation="MSKSKSTRSSKVKDDPDTPAKPKASTSASALRKIFYISQDMLED GTQKLNLEQFYHAGKGKKALFMTKNDNIIMEVVEYSEPRRSWLINSEVCSNGHIYITT PIDVTFLALHHLRKHCSTRAISLDNIYDEEDSSVSRLLTNFIPHASLKCIADVKTAGG DNFYKYNHEKCLAWLSLKTKHVAEALKKAGIYCGHSAISQNYTRSENVVDETAHETDY LRMACDYIGGYISLELHEELAKYLQIPSEKATKNEEKKAAATNTKRKSGDKLKNEISK KQKLENGAAAKLKDSSLLEESPDDDEEENRNKNNSLSEEIIKSPKENLSTPLKEKTMT AKEKSLAKSAKGTKSIASFFMKKTAA" misc_feature 154..>609 /gene="LOC106085201" /note="Ribonuclease H2-B is a subunit of the eukaryotic RNase H complex which cleaves RNA-DNA hybrids; Region: RNase_H2-B; cd09270" /db_xref="CDD:187751" misc_feature order(160..168,211..213,280..282,304..318) /gene="LOC106085201" /note="heterotrimeric interface; other site" /db_xref="CDD:187751" ORIGIN 1 cccatccttc aaaagaaata gaaatagtcc acaataacta aaaagtgaaa cgaaatgagt 61 aaatcaaaat caactcgatc cagcaaagta aaagatgatc cggatacacc cgcaaaacca 121 aaggccagta catctgcatc cgccttaagg aaaatatttt acatatctca ggatatgctg 181 gaagatggga cgcaaaagtt gaatctggag caattttatc atgcgggaaa aggcaagaaa 241 gcattattta tgacaaaaaa tgataacatt ataatggaag tggtggagta ttcagagcct 301 agaagaagtt ggcttatcaa cagcgaggtg tgttccaatg ggcatatcta cattaccacc 361 ccgattgatg tgaccttttt agctttgcac cacttgcgca agcattgttc gactagagcc 421 atctccttgg ataacatata tgatgaggag gattccagtg tttcgaggct gcttaccaat 481 tttataccgc atgcgtcgct aaaatgtatt gccgatgtta aaactgcagg aggagataat 541 ttctataaat ataaccacga gaaatgttta gcatggttgt cgcttaaaac aaaacatgtg 601 gcagaggcgt tgaaaaaagc cggcatatac tgtggccaca gtgccatatc gcaaaactat 661 acacgaagtg aaaacgtagt agacgagact gcccatgaga cggattacct gcgtatggcc 721 tgtgattata ttgggggcta tatatccctg gaattgcatg aggaacttgc taaatatttg 781 caaataccct ctgagaaagc gacaaagaat gaggaaaaga aggcagcggc gactaatact 841 aaacgtaagt ccggcgacaa gctaaagaat gaaatctcga aaaagcaaaa attggaaaat 901 ggggcagcag ctaaattgaa ggattccagt ttgttggaag aatcgccgga cgatgatgaa 961 gaagaaaatc gtaataagaa caattcttta agtgaggaga tcataaaatc acccaaagag 1021 aacttatcta ctccgttgaa ggaaaagaca atgacagcta aagaaaaatc attggcgaag 1081 agtgctaaag gtaccaagag tatagcatca ttttttatga aaaagactgc cgcataatat 1141 aatgtagaat gt