Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085152


LOCUS       XM_013249218             667 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085152), mRNA.
ACCESSION   XM_013249218
VERSION     XM_013249218.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249218.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..667
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..667
                     /gene="LOC106085152"
                     /note="uncharacterized LOC106085152; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106085152"
     CDS             252..512
                     /gene="LOC106085152"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085152"
                     /protein_id="XP_013104672.2"
                     /db_xref="GeneID:106085152"
                     /translation="MATSTKAKSVYRLFVGNLPWTVGHPELKQYFKHFGRVVNANVIF
                     DKKTGLSRGYGFVTVHSLKSMQAIENEQKHALEGNYLNIQKT"
     polyA_site      667
                     /gene="LOC106085152"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaataatcat ttctgaacta ctaaatattt acttacaata aaagaatagg aaaaattttg
       61 acatttaagc gtacaattga cagggtgggg cacctaacag cagtgctttt gttgttcttg
      121 gccaaatgac atttcctgtt gttgccccgg tatgtcaaac acaatttacg tttccaaata
      181 ttagaagaaa gcattttaaa gcgataatta cgcaataaat ttaaccaggc gacaattgta
      241 actactcaca aatggcaaca tctacaaaag caaaaagcgt ctatagatta ttcgtcggta
      301 accttccatg gactgtaggt catcctgagt tgaaacagta tttcaaacat tttggtcgtg
      361 tggtaaatgc caatgtaata tttgataaaa agaccggcct ttccagagga tatggatttg
      421 tgacagtaca ttccctgaaa tctatgcaag caattgaaaa cgaacaaaag cacgcgctag
      481 aaggcaatta cttgaatata caaaaaacat agataaaaaa gagaccacca ataattagtt
      541 ttttaagacc aacaaaaata atatacaaaa aaaaaacagc aaagcatacc gagaaagcat
      601 agagcaccat ggaatcgcaa cagtctggtg acagtgactg ggaattcgat gaactggaag
      661 atgaaaa