Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249218 667 bp mRNA linear INV 02-SEP-2023 (LOC106085152), mRNA. ACCESSION XM_013249218 VERSION XM_013249218.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249218.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..667 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..667 /gene="LOC106085152" /note="uncharacterized LOC106085152; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106085152" CDS 252..512 /gene="LOC106085152" /codon_start=1 /product="uncharacterized protein LOC106085152" /protein_id="XP_013104672.2" /db_xref="GeneID:106085152" /translation="MATSTKAKSVYRLFVGNLPWTVGHPELKQYFKHFGRVVNANVIF DKKTGLSRGYGFVTVHSLKSMQAIENEQKHALEGNYLNIQKT" polyA_site 667 /gene="LOC106085152" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaataatcat ttctgaacta ctaaatattt acttacaata aaagaatagg aaaaattttg 61 acatttaagc gtacaattga cagggtgggg cacctaacag cagtgctttt gttgttcttg 121 gccaaatgac atttcctgtt gttgccccgg tatgtcaaac acaatttacg tttccaaata 181 ttagaagaaa gcattttaaa gcgataatta cgcaataaat ttaaccaggc gacaattgta 241 actactcaca aatggcaaca tctacaaaag caaaaagcgt ctatagatta ttcgtcggta 301 accttccatg gactgtaggt catcctgagt tgaaacagta tttcaaacat tttggtcgtg 361 tggtaaatgc caatgtaata tttgataaaa agaccggcct ttccagagga tatggatttg 421 tgacagtaca ttccctgaaa tctatgcaag caattgaaaa cgaacaaaag cacgcgctag 481 aaggcaatta cttgaatata caaaaaacat agataaaaaa gagaccacca ataattagtt 541 ttttaagacc aacaaaaata atatacaaaa aaaaaacagc aaagcatacc gagaaagcat 601 agagcaccat ggaatcgcaa cagtctggtg acagtgactg ggaattcgat gaactggaag 661 atgaaaa