Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cyclin-dependent kinase 1


LOCUS       XM_013249211            1063 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085147), mRNA.
ACCESSION   XM_013249211
VERSION     XM_013249211.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249211.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1063
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1063
                     /gene="LOC106085147"
                     /note="cyclin-dependent kinase 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 33
                     Proteins"
                     /db_xref="GeneID:106085147"
     CDS             91..987
                     /gene="LOC106085147"
                     /codon_start=1
                     /product="cyclin-dependent kinase 1"
                     /protein_id="XP_013104665.1"
                     /db_xref="GeneID:106085147"
                     /translation="MEDFQKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGI
                     PSTAIREISLLKELKHPNIVSLVDVLMEESRLYLIFEFLSMDLKKYMDSLPPEKPLDS
                     ELVRSYLYQITNAILFCHKRRVLHRDLKPQNLLIDKNGIIKVADFGLGRSFGIPVRIY
                     THEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFR
                     ILKTPTEEIWPGVTSLPDYKNTFPCWSTNQLPNQLKNLNSDGIDLIQKMLIYDPVHRI
                     SAKDVLEHAYFDGFDTKLINCQ"
     misc_feature    97..951
                     /gene="LOC106085147"
                     /note="Catalytic domain of the Serine/Threonine Kinase,
                     Cyclin-Dependent protein Kinase 1 from higher eukaryotes;
                     Region: STKc_CDK1_euk; cd07861"
                     /db_xref="CDD:270845"
     misc_feature    order(118..129,142..144,181..183,187..189,238..240,
                     280..282,328..339,346..348,352..357,472..474,478..480,
                     484..489,493..495,526..528,535..537,571..573,577..588,
                     592..594,706..711)
                     /gene="LOC106085147"
                     /note="active site"
                     /db_xref="CDD:270845"
     misc_feature    order(118..129,142..144,181..183,187..189,280..282,
                     328..339,346..348,355..357,484..489,493..495,526..528)
                     /gene="LOC106085147"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270845"
     misc_feature    order(199..201,214..222,226..228,235..240,244..249,
                     256..261,301..303,439..441,448..459,541..549,553..558,
                     568..573,907..909,919..927)
                     /gene="LOC106085147"
                     /note="CDK/cyclin interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:270845"
     misc_feature    order(238..240,352..354,472..474,478..480,535..537,
                     571..573,577..588,592..594,706..711)
                     /gene="LOC106085147"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270845"
     misc_feature    523..594
                     /gene="LOC106085147"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270845"
ORIGIN      
        1 tctctctaca agtacacaaa aaaagtataa aaatttggat caagcgattt ttggcgctac
       61 tgaaaatatt taaagcaatc cattttccaa atggaagatt tccagaagat tgaaaaaatt
      121 ggtgagggaa catatggagt tgtttacaaa ggacgcaaca gacttactgg ccagattgtg
      181 gctatgaaaa aaattcgcct ggaatcggat gatgagggta taccttctac agccataaga
      241 gaaatttctc ttttaaaaga attgaagcat ccgaacattg tgtccctggt agatgtgctc
      301 atggaagaaa gccgattgta tttaatattt gaatttttgt ctatggattt gaaaaaatac
      361 atggactcct tgcccccgga aaagcccttg gacagtgaac ttgtgagaag ttatctctac
      421 caaataacca atgcgatatt attttgccat aaaagacgag ttttacatcg cgatttgaag
      481 ccacaaaatt tgctaattga caaaaacggc atcattaaag tggcagattt tggtcttgga
      541 cgttcgtttg gcattcctgt tcgtatttac acccacgaaa ttgtaacact gtggtacagg
      601 gcaccagaag ttttgctggg atcaccaaga tactcgtgcc ccgtagacat ttggtcaatt
      661 ggttgtatat ttgctgagat ggcaaccagg aagccattgt tccaaggaga ttcagaaatt
      721 gatcagctat tcagaatgtt cagaattctt aaaacaccaa cggaagaaat ttggcccggc
      781 gtaacatcac ttcctgatta taaaaataca ttcccttgct ggtcaacaaa tcaactgcca
      841 aatcaattga agaacttaaa tagcgatggt attgatttga tacaaaaaat gcttatttat
      901 gatccagttc atcgcatatc tgcgaaagat gtattggaac acgcatactt tgatgggttt
      961 gatactaaat taataaattg tcagtgaata atttttatgt aatatgctac tcgtaaatat
     1021 taatctctaa atatacctac atacaccctt tttaaataaa ata