Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249208 460 bp mRNA linear INV 02-SEP-2023 protein 7 homolog (LOC106085145), transcript variant X2, mRNA. ACCESSION XM_013249208 VERSION XM_013249208.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249208.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..460 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..460 /gene="LOC106085145" /note="translation machinery-associated protein 7 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106085145" CDS 177..371 /gene="LOC106085145" /codon_start=1 /product="translation machinery-associated protein 7 homolog" /protein_id="XP_013104662.1" /db_xref="GeneID:106085145" /translation="MSGREGGKKKPLKAPKKDAKELDDDDMAFKQKQKEAQKALEAAK ANASKKGPLVGGGIKKSGKK" misc_feature 183..338 /gene="LOC106085145" /note="Translation machinery associated TMA7; Region: TMA7; pfam09072" /db_xref="CDD:462671" polyA_site 460 /gene="LOC106085145" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gaacatttta ccagccatta catgacaaga gaattcggac accttaccag gcaccagatg 61 tgaaataagt actcagtact aatgtgctgt taatagttgg tattcggttg tcatcgtcgc 121 tgccgatgtt tatattgaac gaatatttta catatttata gaaaaacaaa gaaaaaatgt 181 ccggtcgaga gggtggtaag aaaaaaccat tgaaggcccc caagaaagac gccaaagaac 241 ttgatgatga cgatatggcc tttaaacaaa aacaaaagga agctcaaaag gcattggaag 301 ctgccaaagc taatgcgtcc aagaaaggtc ctctagtggg aggaggaatc aagaagtcgg 361 gcaagaagta aaacacaaaa ttttagcatt tatttgcaat tgtccctcaa ccaagttaac 421 aaataaattt atagattttt ttataattaa aaatattaaa