Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans translation machinery-associated


LOCUS       XM_013249207             456 bp    mRNA    linear   INV 02-SEP-2023
            protein 7 homolog (LOC106085145), transcript variant X1, mRNA.
ACCESSION   XM_013249207
VERSION     XM_013249207.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249207.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..456
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..456
                     /gene="LOC106085145"
                     /note="translation machinery-associated protein 7 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 8 Proteins"
                     /db_xref="GeneID:106085145"
     CDS             173..367
                     /gene="LOC106085145"
                     /codon_start=1
                     /product="translation machinery-associated protein 7
                     homolog"
                     /protein_id="XP_013104661.1"
                     /db_xref="GeneID:106085145"
                     /translation="MSGREGGKKKPLKAPKKDAKELDDDDMAFKQKQKEAQKALEAAK
                     ANASKKGPLVGGGIKKSGKK"
     misc_feature    179..334
                     /gene="LOC106085145"
                     /note="Translation machinery associated TMA7; Region:
                     TMA7; pfam09072"
                     /db_xref="CDD:462671"
     polyA_site      456
                     /gene="LOC106085145"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taccagccat tacatgacaa gagaattcgg acaccttacc aggcaccaga tgtgaaataa
       61 gtactcagta ctaatgtgct gttaatagtt ggtattcggt tgtcatcgtc gctgccgatg
      121 tttatattga acgaatattt tacatattta tagaaaaacg tgcaaagaaa aaatgtccgg
      181 tcgagagggt ggtaagaaaa aaccattgaa ggcccccaag aaagacgcca aagaacttga
      241 tgatgacgat atggccttta aacaaaaaca aaaggaagct caaaaggcat tggaagctgc
      301 caaagctaat gcgtccaaga aaggtcctct agtgggagga ggaatcaaga agtcgggcaa
      361 gaagtaaaac acaaaatttt agcatttatt tgcaattgtc cctcaaccaa gttaacaaat
      421 aaatttatag atttttttat aattaaaaat attaaa