Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249207 456 bp mRNA linear INV 02-SEP-2023 protein 7 homolog (LOC106085145), transcript variant X1, mRNA. ACCESSION XM_013249207 VERSION XM_013249207.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249207.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..456 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..456 /gene="LOC106085145" /note="translation machinery-associated protein 7 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:106085145" CDS 173..367 /gene="LOC106085145" /codon_start=1 /product="translation machinery-associated protein 7 homolog" /protein_id="XP_013104661.1" /db_xref="GeneID:106085145" /translation="MSGREGGKKKPLKAPKKDAKELDDDDMAFKQKQKEAQKALEAAK ANASKKGPLVGGGIKKSGKK" misc_feature 179..334 /gene="LOC106085145" /note="Translation machinery associated TMA7; Region: TMA7; pfam09072" /db_xref="CDD:462671" polyA_site 456 /gene="LOC106085145" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taccagccat tacatgacaa gagaattcgg acaccttacc aggcaccaga tgtgaaataa 61 gtactcagta ctaatgtgct gttaatagtt ggtattcggt tgtcatcgtc gctgccgatg 121 tttatattga acgaatattt tacatattta tagaaaaacg tgcaaagaaa aaatgtccgg 181 tcgagagggt ggtaagaaaa aaccattgaa ggcccccaag aaagacgcca aagaacttga 241 tgatgacgat atggccttta aacaaaaaca aaaggaagct caaaaggcat tggaagctgc 301 caaagctaat gcgtccaaga aaggtcctct agtgggagga ggaatcaaga agtcgggcaa 361 gaagtaaaac acaaaatttt agcatttatt tgcaattgtc cctcaaccaa gttaacaaat 421 aaatttatag atttttttat aattaaaaat attaaa