Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249163 1021 bp mRNA linear INV 02-SEP-2023 (LOC106085116), mRNA. ACCESSION XM_013249163 VERSION XM_013249163.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249163.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1021 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1021 /gene="LOC106085116" /note="uncharacterized LOC106085116; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085116" CDS 358..873 /gene="LOC106085116" /codon_start=1 /product="uncharacterized protein LOC106085116" /protein_id="XP_013104617.2" /db_xref="GeneID:106085116" /translation="MGQTFTLSNLVQNIYPSSGRMTTSTTRVGTLSCKFCAHEHHQLQ LHSRIISGIEWVHRLRIVGGFILGVAATVNGDNQRYRVDSLRESSADPGLSACDTRYD KWDLDTTLKLDNSFSWASEPTFFIQPWVVSFEQQPQTIWCKPPSCHQADRRFANIHKE IFVRVCIRGRT" ORIGIN 1 gttttcaatg cagatgaaat ttctcaaaga ttgatctgca aaacataacc ctggtaatgt 61 agaaatatca cggtattata ttggttttac tttccctttc aattcatgaa atcaaatcaa 121 aaagtgttgg tcacagttaa taataaattc cttattcccc tcttccaata aaaaaaatca 181 gaagcagcca tagacaacaa taaaatcaaa cccatttcgc agagtacgaa tttcatattc 241 aatttggggt caagtgtctg gtgcccgttc ctcaaactaa aatccgcaaa caaaaatgaa 301 gtcatatcag tacaatatgt ggttcaaagg agtacagtat aaccttgaaa taacaatatg 361 ggtcaaacct ttacattatc aaaccttgtg caaaacattt atccaagctc ggggagaatg 421 actacaagca ccacacgggt tggaactctg agctgcaaat tttgtgctca tgaacatcat 481 cagctgcaac tgcattcgcg gataatcagc ggtatcgagt gggtccacag gttgcggata 541 gtgggaggct tcatactcgg agtagctgca actgtaaacg gcgacaatca gcggtatcga 601 gtggatagtc tgcgtgaaag ttcggccgac cccggcctaa gtgcatgtga tactcgatac 661 gacaagtggg atttggatac aactctgaaa ttggacaatt ctttcagctg ggcaagtgag 721 ccaaccttct ttattcaacc atgggtggtc tcatttgaac aacaacccca aaccatatgg 781 tgtaaaccgc catcttgtca tcaagctgat cgacgttttg ccaacataca caaagaaatt 841 tttgtgcgtg tatgtatacg tgggcgaaca tgagcagaga atatgcgaga aaaaagataa 901 caactacgag aaagcaagca aaaatctgtc atcttaatac cgtcaaacct ggccggctgt 961 taacgcgtga gaccaccttt ttaaatccgc cttgggagta catgtgccgt ctgagagatg 1021 a