Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085116


LOCUS       XM_013249163            1021 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085116), mRNA.
ACCESSION   XM_013249163
VERSION     XM_013249163.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249163.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1021
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1021
                     /gene="LOC106085116"
                     /note="uncharacterized LOC106085116; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085116"
     CDS             358..873
                     /gene="LOC106085116"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085116"
                     /protein_id="XP_013104617.2"
                     /db_xref="GeneID:106085116"
                     /translation="MGQTFTLSNLVQNIYPSSGRMTTSTTRVGTLSCKFCAHEHHQLQ
                     LHSRIISGIEWVHRLRIVGGFILGVAATVNGDNQRYRVDSLRESSADPGLSACDTRYD
                     KWDLDTTLKLDNSFSWASEPTFFIQPWVVSFEQQPQTIWCKPPSCHQADRRFANIHKE
                     IFVRVCIRGRT"
ORIGIN      
        1 gttttcaatg cagatgaaat ttctcaaaga ttgatctgca aaacataacc ctggtaatgt
       61 agaaatatca cggtattata ttggttttac tttccctttc aattcatgaa atcaaatcaa
      121 aaagtgttgg tcacagttaa taataaattc cttattcccc tcttccaata aaaaaaatca
      181 gaagcagcca tagacaacaa taaaatcaaa cccatttcgc agagtacgaa tttcatattc
      241 aatttggggt caagtgtctg gtgcccgttc ctcaaactaa aatccgcaaa caaaaatgaa
      301 gtcatatcag tacaatatgt ggttcaaagg agtacagtat aaccttgaaa taacaatatg
      361 ggtcaaacct ttacattatc aaaccttgtg caaaacattt atccaagctc ggggagaatg
      421 actacaagca ccacacgggt tggaactctg agctgcaaat tttgtgctca tgaacatcat
      481 cagctgcaac tgcattcgcg gataatcagc ggtatcgagt gggtccacag gttgcggata
      541 gtgggaggct tcatactcgg agtagctgca actgtaaacg gcgacaatca gcggtatcga
      601 gtggatagtc tgcgtgaaag ttcggccgac cccggcctaa gtgcatgtga tactcgatac
      661 gacaagtggg atttggatac aactctgaaa ttggacaatt ctttcagctg ggcaagtgag
      721 ccaaccttct ttattcaacc atgggtggtc tcatttgaac aacaacccca aaccatatgg
      781 tgtaaaccgc catcttgtca tcaagctgat cgacgttttg ccaacataca caaagaaatt
      841 tttgtgcgtg tatgtatacg tgggcgaaca tgagcagaga atatgcgaga aaaaagataa
      901 caactacgag aaagcaagca aaaatctgtc atcttaatac cgtcaaacct ggccggctgt
      961 taacgcgtga gaccaccttt ttaaatccgc cttgggagta catgtgccgt ctgagagatg
     1021 a