Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249160 328 bp mRNA linear INV 02-SEP-2023 (LOC106085114), mRNA. ACCESSION XM_013249160 VERSION XM_013249160.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249160.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..328 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..328 /gene="LOC106085114" /note="uncharacterized LOC106085114; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106085114" CDS 1..225 /gene="LOC106085114" /codon_start=1 /product="uncharacterized protein LOC106085114" /protein_id="XP_013104614.1" /db_xref="GeneID:106085114" /translation="MSAPAARQSVGLIKRAWNEIPDIVGGSVLAIIGLGLAGIGLVNY YSHDGDNRRYKYGYVIMRPDDPRAAKVHKD" polyA_site 328 /gene="LOC106085114" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgtctgctc cagctgctcg ccaatccgtc ggtctcatta aaagagcatg gaatgagatt 61 cccgatattg tcggtggctc tgttttagcc attattggtt tgggtcttgc tggaattggt 121 ttggtaaact attatagcca tgatggtgac aatcgccgct ataagtacgg ctatgttatt 181 atgcgtcccg atgatccaag agctgctaaa gtccacaagg actaaattta ttgattgttt 241 agtgcaaatg tgtgattatc attattattc gaagaaaaac aaaaatacaa cataaaacag 301 atttatctta ttgatttatt gtcccaaa