Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085114


LOCUS       XM_013249160             328 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085114), mRNA.
ACCESSION   XM_013249160
VERSION     XM_013249160.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249160.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..328
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..328
                     /gene="LOC106085114"
                     /note="uncharacterized LOC106085114; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106085114"
     CDS             1..225
                     /gene="LOC106085114"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085114"
                     /protein_id="XP_013104614.1"
                     /db_xref="GeneID:106085114"
                     /translation="MSAPAARQSVGLIKRAWNEIPDIVGGSVLAIIGLGLAGIGLVNY
                     YSHDGDNRRYKYGYVIMRPDDPRAAKVHKD"
     polyA_site      328
                     /gene="LOC106085114"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgtctgctc cagctgctcg ccaatccgtc ggtctcatta aaagagcatg gaatgagatt
       61 cccgatattg tcggtggctc tgttttagcc attattggtt tgggtcttgc tggaattggt
      121 ttggtaaact attatagcca tgatggtgac aatcgccgct ataagtacgg ctatgttatt
      181 atgcgtcccg atgatccaag agctgctaaa gtccacaagg actaaattta ttgattgttt
      241 agtgcaaatg tgtgattatc attattattc gaagaaaaac aaaaatacaa cataaaacag
      301 atttatctta ttgatttatt gtcccaaa