Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249159 652 bp mRNA linear INV 02-SEP-2023 (LOC106085113), transcript variant X1, mRNA. ACCESSION XM_013249159 VERSION XM_013249159.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249159.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..652 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..652 /gene="LOC106085113" /note="uncharacterized LOC106085113; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106085113" CDS 79..624 /gene="LOC106085113" /codon_start=1 /product="uncharacterized protein LOC106085113 isoform X1" /protein_id="XP_013104613.2" /db_xref="GeneID:106085113" /translation="MTLSHNIVKMLEYCTGGTLQDSNIYPPWICFMCIKQLEICFRFL KRYDLAQKEFEASHNQFQEESSDFQSALLDEDGKVEKRICHANLSTNAEFSETSISSK QNTLEPSAVQAPISEYSSSEGTTFGYRDSSQEPGVSLEGARNSYGDVVCSICNKTFLT GKGLNLHLKLYHKQKNISLGQ" polyA_site 652 /gene="LOC106085113" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttctttttt agaagtgtag tttagttacc cagtaatcgg tttgaattgt caacatagat 61 atacaggata ctgaaaaaat gaccctaagt cacaatattg tcaaaatgtt ggaatattgt 121 acaggcggaa ctcttcaaga ttcaaatata tacccaccat ggatttgctt tatgtgcatt 181 aagcagttag agatttgctt tcgttttcta aaacgatatg atctagccca aaaggagttc 241 gaagccagtc acaatcaatt tcaggaagaa tcttccgact tccaatcagc gttattagat 301 gaagatggta aagtggagaa aagaatttgc catgccaatc tcagcaccaa tgcagaattt 361 agtgaaacga gtataagttc caaacaaaat accttggagc catcagcagt tcaagcacca 421 ataagtgaat attcatctag cgaaggaaca actttcgggt atagagattc atcacaggag 481 ccaggtgtaa gtctagaagg cgctcggaat tcctatggag atgtggtatg ctctatttgt 541 aataagacct ttcttaccgg caaaggttta aatttacacc ttaaattata tcacaaacaa 601 aaaaacatta gtttgggaca ataaatcaat aagataaatc tgttttatgt tg