Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085113


LOCUS       XM_013249159             652 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085113), transcript variant X1, mRNA.
ACCESSION   XM_013249159
VERSION     XM_013249159.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249159.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..652
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..652
                     /gene="LOC106085113"
                     /note="uncharacterized LOC106085113; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106085113"
     CDS             79..624
                     /gene="LOC106085113"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085113 isoform X1"
                     /protein_id="XP_013104613.2"
                     /db_xref="GeneID:106085113"
                     /translation="MTLSHNIVKMLEYCTGGTLQDSNIYPPWICFMCIKQLEICFRFL
                     KRYDLAQKEFEASHNQFQEESSDFQSALLDEDGKVEKRICHANLSTNAEFSETSISSK
                     QNTLEPSAVQAPISEYSSSEGTTFGYRDSSQEPGVSLEGARNSYGDVVCSICNKTFLT
                     GKGLNLHLKLYHKQKNISLGQ"
     polyA_site      652
                     /gene="LOC106085113"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttctttttt agaagtgtag tttagttacc cagtaatcgg tttgaattgt caacatagat
       61 atacaggata ctgaaaaaat gaccctaagt cacaatattg tcaaaatgtt ggaatattgt
      121 acaggcggaa ctcttcaaga ttcaaatata tacccaccat ggatttgctt tatgtgcatt
      181 aagcagttag agatttgctt tcgttttcta aaacgatatg atctagccca aaaggagttc
      241 gaagccagtc acaatcaatt tcaggaagaa tcttccgact tccaatcagc gttattagat
      301 gaagatggta aagtggagaa aagaatttgc catgccaatc tcagcaccaa tgcagaattt
      361 agtgaaacga gtataagttc caaacaaaat accttggagc catcagcagt tcaagcacca
      421 ataagtgaat attcatctag cgaaggaaca actttcgggt atagagattc atcacaggag
      481 ccaggtgtaa gtctagaagg cgctcggaat tcctatggag atgtggtatg ctctatttgt
      541 aataagacct ttcttaccgg caaaggttta aatttacacc ttaaattata tcacaaacaa
      601 aaaaacatta gtttgggaca ataaatcaat aagataaatc tgttttatgt tg