Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249142 631 bp mRNA linear INV 02-SEP-2023 (LOC106085103), transcript variant X2, mRNA. ACCESSION XM_013249142 VERSION XM_013249142.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249142.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..631 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..631 /gene="LOC106085103" /note="protein BUD31 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106085103" CDS 36..470 /gene="LOC106085103" /codon_start=1 /product="protein BUD31 homolog" /protein_id="XP_013104596.1" /db_xref="GeneID:106085103" /translation="MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITE SLWPIFKIHHQKSRYIYDLFYRRKAISRELYDYCLKEKIADANLIAKWKKSGYENLCC LRCIQTRDTNFGTNCICRVPKSKLEEGRVVECVHCGCRGCSG" misc_feature 36..464 /gene="LOC106085103" /note="G10 protein; Region: G10; pfam01125" /db_xref="CDD:426066" polyA_site 631 /gene="LOC106085103" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gttgaaatag aagaagcata gttaggccaa taaacatgcc caaagtcaga agatcacgta 61 agccaccgcc ggatggctgg gaattgatag agccaacatt ggaggaattg gaacaaaaaa 121 tgcgtgaagc tgaaacggag ccacacgaag gtaagcgtat cacagaatcc ctatggccaa 181 tttttaaaat ccaccatcag aagtcacgtt acatatatga tctgttctat cgccgcaagg 241 ccataagtcg tgaactctac gactattgtc ttaaggagaa aattgccgat gctaacttaa 301 ttgccaaatg gaaaaagtct ggttatgaaa atctttgctg tcttcgatgc atacaaacgc 361 gtgataccaa tttcggtacg aattgtattt gccgtgtgcc caaatcaaag ctagaagaag 421 gacgtgtggt ggaatgtgtt cactgtggat gtagaggttg ttcgggctaa aaacaacggt 481 ttaaacatca tgctgtaatc gtgatgacag tcgtagttga ttagcatcta gtagtaaaag 541 ttaatttttc acaattcctt gacattttta cttttgtttt tgatataatt aagatttttc 601 taataataaa aaagcaagaa atgataaagt a