Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein BUD31 homolog


LOCUS       XM_013249142             631 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085103), transcript variant X2, mRNA.
ACCESSION   XM_013249142
VERSION     XM_013249142.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249142.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..631
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..631
                     /gene="LOC106085103"
                     /note="protein BUD31 homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 10
                     Proteins"
                     /db_xref="GeneID:106085103"
     CDS             36..470
                     /gene="LOC106085103"
                     /codon_start=1
                     /product="protein BUD31 homolog"
                     /protein_id="XP_013104596.1"
                     /db_xref="GeneID:106085103"
                     /translation="MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITE
                     SLWPIFKIHHQKSRYIYDLFYRRKAISRELYDYCLKEKIADANLIAKWKKSGYENLCC
                     LRCIQTRDTNFGTNCICRVPKSKLEEGRVVECVHCGCRGCSG"
     misc_feature    36..464
                     /gene="LOC106085103"
                     /note="G10 protein; Region: G10; pfam01125"
                     /db_xref="CDD:426066"
     polyA_site      631
                     /gene="LOC106085103"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gttgaaatag aagaagcata gttaggccaa taaacatgcc caaagtcaga agatcacgta
       61 agccaccgcc ggatggctgg gaattgatag agccaacatt ggaggaattg gaacaaaaaa
      121 tgcgtgaagc tgaaacggag ccacacgaag gtaagcgtat cacagaatcc ctatggccaa
      181 tttttaaaat ccaccatcag aagtcacgtt acatatatga tctgttctat cgccgcaagg
      241 ccataagtcg tgaactctac gactattgtc ttaaggagaa aattgccgat gctaacttaa
      301 ttgccaaatg gaaaaagtct ggttatgaaa atctttgctg tcttcgatgc atacaaacgc
      361 gtgataccaa tttcggtacg aattgtattt gccgtgtgcc caaatcaaag ctagaagaag
      421 gacgtgtggt ggaatgtgtt cactgtggat gtagaggttg ttcgggctaa aaacaacggt
      481 ttaaacatca tgctgtaatc gtgatgacag tcgtagttga ttagcatcta gtagtaaaag
      541 ttaatttttc acaattcctt gacattttta cttttgtttt tgatataatt aagatttttc
      601 taataataaa aaagcaagaa atgataaagt a