Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249141 676 bp mRNA linear INV 02-SEP-2023 (LOC106085103), transcript variant X1, mRNA. ACCESSION XM_013249141 VERSION XM_013249141.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249141.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..676 /gene="LOC106085103" /note="protein BUD31 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106085103" CDS 81..515 /gene="LOC106085103" /codon_start=1 /product="protein BUD31 homolog" /protein_id="XP_013104595.1" /db_xref="GeneID:106085103" /translation="MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITE SLWPIFKIHHQKSRYIYDLFYRRKAISRELYDYCLKEKIADANLIAKWKKSGYENLCC LRCIQTRDTNFGTNCICRVPKSKLEEGRVVECVHCGCRGCSG" misc_feature 81..509 /gene="LOC106085103" /note="G10 protein; Region: G10; pfam01125" /db_xref="CDD:426066" polyA_site 676 /gene="LOC106085103" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cttcgactat tcgattagtc gattaatccc tagtaaggca ttgttgaaat agaagaagca 61 tagttaggcc aataaacagc atgcccaaag tcagaagatc acgtaagcca ccgccggatg 121 gctgggaatt gatagagcca acattggagg aattggaaca aaaaatgcgt gaagctgaaa 181 cggagccaca cgaaggtaag cgtatcacag aatccctatg gccaattttt aaaatccacc 241 atcagaagtc acgttacata tatgatctgt tctatcgccg caaggccata agtcgtgaac 301 tctacgacta ttgtcttaag gagaaaattg ccgatgctaa cttaattgcc aaatggaaaa 361 agtctggtta tgaaaatctt tgctgtcttc gatgcataca aacgcgtgat accaatttcg 421 gtacgaattg tatttgccgt gtgcccaaat caaagctaga agaaggacgt gtggtggaat 481 gtgttcactg tggatgtaga ggttgttcgg gctaaaaaca acggtttaaa catcatgctg 541 taatcgtgat gacagtcgta gttgattagc atctagtagt aaaagttaat ttttcacaat 601 tccttgacat ttttactttt gtttttgata taattaagat ttttctaata ataaaaaagc 661 aagaaatgat aaagta