Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106085102


LOCUS       XM_013249140             889 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106085102), mRNA.
ACCESSION   XM_013249140
VERSION     XM_013249140.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249140.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..889
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..889
                     /gene="LOC106085102"
                     /note="uncharacterized LOC106085102; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106085102"
     CDS             152..427
                     /gene="LOC106085102"
                     /codon_start=1
                     /product="uncharacterized protein LOC106085102"
                     /protein_id="XP_013104594.1"
                     /db_xref="GeneID:106085102"
                     /translation="MEQQLERALNEINSQPDTVGCLITNRQGLCLGAAGKINPKMSGV
                     GMALSEQVCKLEPNLNPPTIVLYSGNKRCIIQKDGEITGIIYKDSSN"
     misc_feature    152..412
                     /gene="LOC106085102"
                     /note="Ragulator complex protein LAMTOR5; Region: LAMTOR5;
                     pfam16672"
                     /db_xref="CDD:406957"
     polyA_site      889
                     /gene="LOC106085102"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caatcagctg tcattgtcca acactgaaaa acccaaagag acaggaaata tcgtaaacaa
       61 aaaaagtcgt cgtatttcat tacttattaa gaattaatag gacattgcat attttttaca
      121 ttaaaagtat taagaagtaa gaaaaaaaaa catggaacag caactagaga gagctttaaa
      181 tgaaatcaat tcacagccag atactgtggg atgtctgata accaatcgtc agggcctttg
      241 tctaggagct gctggtaaaa ttaatcccaa aatgtctggt gttggtatgg ccttatcaga
      301 gcaagtgtgt aaattggaac ccaacctaaa cccacccact attgtactgt atagtgggaa
      361 taaacgttgt attatccaaa aggatggcga aataactggc attatttata aagacagttc
      421 taattagttc taatgaatta gaaaactcta aacagtcccg tagatataca tgaaggggta
      481 tgaattcgct gaattgcaac aaatatcttt tatgcatatt tttgccattt tgagataaca
      541 aacggaaaaa caaaacagtg tatcaggtca aacaaccaca acgtgctaaa tgtgccgcgt
      601 tagtagtact ttggacgaat gtctcaatca ttcatgcttc catttgtgat taaatgttaa
      661 ttatatgaaa tatatataaa tttagtttac atacgtacta cttctacttc taaaatatgt
      721 agatttaaga ttaatttttt tcattatatg cataagcaaa actcaaattt aaaatttttt
      781 tgcatctata caaaatttgt ataaaactat ttccgaatca aataaaaacc taagtaggaa
      841 aacaagcaaa tgtgattttt aataaaaaaa ggtttaaaaa tgatttaaa