Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249140 889 bp mRNA linear INV 02-SEP-2023 (LOC106085102), mRNA. ACCESSION XM_013249140 VERSION XM_013249140.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249140.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..889 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..889 /gene="LOC106085102" /note="uncharacterized LOC106085102; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106085102" CDS 152..427 /gene="LOC106085102" /codon_start=1 /product="uncharacterized protein LOC106085102" /protein_id="XP_013104594.1" /db_xref="GeneID:106085102" /translation="MEQQLERALNEINSQPDTVGCLITNRQGLCLGAAGKINPKMSGV GMALSEQVCKLEPNLNPPTIVLYSGNKRCIIQKDGEITGIIYKDSSN" misc_feature 152..412 /gene="LOC106085102" /note="Ragulator complex protein LAMTOR5; Region: LAMTOR5; pfam16672" /db_xref="CDD:406957" polyA_site 889 /gene="LOC106085102" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 caatcagctg tcattgtcca acactgaaaa acccaaagag acaggaaata tcgtaaacaa 61 aaaaagtcgt cgtatttcat tacttattaa gaattaatag gacattgcat attttttaca 121 ttaaaagtat taagaagtaa gaaaaaaaaa catggaacag caactagaga gagctttaaa 181 tgaaatcaat tcacagccag atactgtggg atgtctgata accaatcgtc agggcctttg 241 tctaggagct gctggtaaaa ttaatcccaa aatgtctggt gttggtatgg ccttatcaga 301 gcaagtgtgt aaattggaac ccaacctaaa cccacccact attgtactgt atagtgggaa 361 taaacgttgt attatccaaa aggatggcga aataactggc attatttata aagacagttc 421 taattagttc taatgaatta gaaaactcta aacagtcccg tagatataca tgaaggggta 481 tgaattcgct gaattgcaac aaatatcttt tatgcatatt tttgccattt tgagataaca 541 aacggaaaaa caaaacagtg tatcaggtca aacaaccaca acgtgctaaa tgtgccgcgt 601 tagtagtact ttggacgaat gtctcaatca ttcatgcttc catttgtgat taaatgttaa 661 ttatatgaaa tatatataaa tttagtttac atacgtacta cttctacttc taaaatatgt 721 agatttaaga ttaatttttt tcattatatg cataagcaaa actcaaattt aaaatttttt 781 tgcatctata caaaatttgt ataaaactat ttccgaatca aataaaaacc taagtaggaa 841 aacaagcaaa tgtgattttt aataaaaaaa ggtttaaaaa tgatttaaa