Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013249033 746 bp mRNA linear INV 02-SEP-2023 subunit ALG14 homolog (LOC106085033), mRNA. ACCESSION XM_013249033 VERSION XM_013249033.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013249033.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..746 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..746 /gene="LOC106085033" /note="UDP-N-acetylglucosamine transferase subunit ALG14 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106085033" CDS 82..651 /gene="LOC106085033" /codon_start=1 /product="UDP-N-acetylglucosamine transferase subunit ALG14 homolog" /protein_id="XP_013104487.2" /db_xref="GeneID:106085033" /translation="MEDIHPVWCILGSGGHTAEMCIILQGLLRQTKDISKYKPMKFLV ANTDQTSKDKVQLTMSELEQPATEDDFIYIPRAREVGQSWFTTVFSFLYALLWSFWLV FKEKPRLILCNGPGTCVPFCLAGFVQNLARRSKTKLVYVESFCRVNDISMSGRILLPY LDVMIVQWEPLTKIEYLGCKKIKYFGNIL" polyA_site 746 /gene="LOC106085033" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccacaatcaa aacaacacat ttgcccatta tatcaatacg tcatattcca aaaaataaaa 61 cacttgaaga tcctcttaaa aatggaggat attcatccag tgtggtgcat tctgggctcg 121 ggtggtcaca cagctgaaat gtgcatcatt ctgcagggac tgctgcgaca aaccaaagat 181 attagcaagt acaaaccaat gaaatttttg gtagccaata cagaccaaac atccaaagac 241 aaagttcagc taaccatgag tgagctggag cagccggcaa cagaggatga ctttatttat 301 ataccaagag cgagagaagt tggccagagt tggtttacca cagttttctc cttcctctac 361 gccttgttgt ggagtttttg gttggtgttc aaggagaagc cccgtctcat actgtgtaat 421 ggaccgggca catgtgtacc cttttgcttg gcaggtttcg tgcagaattt ggcacgtcga 481 tcgaaaacca aactcgtgta tgtagagagt ttttgtcggg tgaacgatat ttcaatgtcc 541 ggcaggatat tgctacccta tctggatgtc atgattgttc agtgggaacc tctaacgaaa 601 atagaatatt tgggttgtaa gaaaattaaa tattttggca atattttgta agcaaacaca 661 cacacacaca cgcaacacgt acgagacaaa caacaaagat ttattttgta aggttaacaa 721 ataaaaatat aaaaattccg ttttaa