Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans UDP-N-acetylglucosamine transferase


LOCUS       XM_013249033             746 bp    mRNA    linear   INV 02-SEP-2023
            subunit ALG14 homolog (LOC106085033), mRNA.
ACCESSION   XM_013249033
VERSION     XM_013249033.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249033.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..746
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..746
                     /gene="LOC106085033"
                     /note="UDP-N-acetylglucosamine transferase subunit ALG14
                     homolog; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:106085033"
     CDS             82..651
                     /gene="LOC106085033"
                     /codon_start=1
                     /product="UDP-N-acetylglucosamine transferase subunit
                     ALG14 homolog"
                     /protein_id="XP_013104487.2"
                     /db_xref="GeneID:106085033"
                     /translation="MEDIHPVWCILGSGGHTAEMCIILQGLLRQTKDISKYKPMKFLV
                     ANTDQTSKDKVQLTMSELEQPATEDDFIYIPRAREVGQSWFTTVFSFLYALLWSFWLV
                     FKEKPRLILCNGPGTCVPFCLAGFVQNLARRSKTKLVYVESFCRVNDISMSGRILLPY
                     LDVMIVQWEPLTKIEYLGCKKIKYFGNIL"
     polyA_site      746
                     /gene="LOC106085033"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccacaatcaa aacaacacat ttgcccatta tatcaatacg tcatattcca aaaaataaaa
       61 cacttgaaga tcctcttaaa aatggaggat attcatccag tgtggtgcat tctgggctcg
      121 ggtggtcaca cagctgaaat gtgcatcatt ctgcagggac tgctgcgaca aaccaaagat
      181 attagcaagt acaaaccaat gaaatttttg gtagccaata cagaccaaac atccaaagac
      241 aaagttcagc taaccatgag tgagctggag cagccggcaa cagaggatga ctttatttat
      301 ataccaagag cgagagaagt tggccagagt tggtttacca cagttttctc cttcctctac
      361 gccttgttgt ggagtttttg gttggtgttc aaggagaagc cccgtctcat actgtgtaat
      421 ggaccgggca catgtgtacc cttttgcttg gcaggtttcg tgcagaattt ggcacgtcga
      481 tcgaaaacca aactcgtgta tgtagagagt ttttgtcggg tgaacgatat ttcaatgtcc
      541 ggcaggatat tgctacccta tctggatgtc atgattgttc agtgggaacc tctaacgaaa
      601 atagaatatt tgggttgtaa gaaaattaaa tattttggca atattttgta agcaaacaca
      661 cacacacaca cgcaacacgt acgagacaaa caacaaagat ttattttgta aggttaacaa
      721 ataaaaatat aaaaattccg ttttaa