Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans


LOCUS       XM_013249026            1055 bp    mRNA    linear   INV 02-SEP-2023
            2-methoxy-6-polyprenyl-1,4-benzoquinol methylase,
            mitochondrial-like (LOC106085024), mRNA.
ACCESSION   XM_013249026
VERSION     XM_013249026.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013249026.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1055
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1055
                     /gene="LOC106085024"
                     /note="2-methoxy-6-polyprenyl-1,4-benzoquinol methylase,
                     mitochondrial-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:106085024"
     CDS             48..992
                     /gene="LOC106085024"
                     /codon_start=1
                     /product="2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase, mitochondrial-like"
                     /protein_id="XP_013104480.1"
                     /db_xref="GeneID:106085024"
                     /translation="MNSRRVFHWKSLSNLCQHEVLLQRNQSNSYQQTAKMEAYNDRVS
                     ETHKSSEKRTKFFGSEQVTPGERNQKVNKMFTDMADSYDRLLDVMSLGMHRVWKDMLV
                     NKLAPQPGICLLDMAGGTGDIPIRVLKHLSMQSNPKGIKSALTVLDINQNMLNVGEQR
                     ARNLGLTDRSLPHVTVEWKCADAENLPYTDNSFNAYTTSFGVRNVTNMERVLQEAYRV
                     LQPGGRFLCLEFSHLNNYPMQFAFNQYTDKVIPGLFLLMSGSLEQANYLSTSIRNFPN
                     QETFKLMIQEAGFEMVHYENINFGVVSIHTGFKLRGLR"
     misc_feature    231..977
                     /gene="LOC106085024"
                     /note="bifunctional demethylmenaquinone
                     methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol
                     methylase UbiE; Region: ubiE; PRK00216"
                     /db_xref="CDD:234689"
     misc_feature    order(393..413,489..494,588..596,639..641)
                     /gene="LOC106085024"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
ORIGIN      
        1 tttagctagt tcaacaagtg ttgctaaagg aactttatca ggtcacaatg aattctagga
       61 gagtttttca ttggaaatca ttgagcaatc tttgccaaca tgaagtttta ttgcaaagaa
      121 accaaagtaa ctcataccaa caaacagcca aaatggaagc ttacaatgac agggtctctg
      181 aaacacacaa atcctccgaa aagcgaacga agttctttgg ttcggaacaa gttaccccag
      241 gagaaagaaa ccaaaaggtc aataaaatgt ttacggatat ggcagactct tatgatcgcc
      301 ttctcgatgt catgtctttg ggtatgcatc gtgtgtggaa ggatatgcta gtgaataagt
      361 tggcacctca acctggtata tgcctcttgg atatggctgg tggcacaggt gacataccaa
      421 ttagagtttt aaaacatttg tccatgcaat cgaatcccaa gggcattaaa agtgctctca
      481 ccgtattgga tatcaatcag aacatgttga atgtgggaga acaaagagcc cgaaacctgg
      541 gtctaacgga ccgtagcttg ccccatgtga ccgtggaatg gaagtgtgcg gatgcagaaa
      601 acttaccata taccgataat agttttaatg cttatactac atcatttggt gttagaaatg
      661 tcaccaatat ggaacgggtg ttgcaagaag cctatcgtgt gctgcagcca ggtggccgtt
      721 tcttgtgttt agaatttagt catctcaata attatcccat gcaatttgca ttcaatcaat
      781 atacggataa agtgattcca ggtttattcc ttttgatgtc cggcagtttg gaacaggcca
      841 actatttgag tacaagcata cgcaacttcc ccaatcagga aacctttaaa ttaatgattc
      901 aagaggctgg atttgagatg gtccattatg agaacataaa tttcggtgtt gttagcatcc
      961 atacgggatt caagttaagg ggtctaagat gatatggtgg cctatatgaa agaaaaaata
     1021 aaacttaatg ctattacact ggtcagcaaa atgaa